BLASTX nr result
ID: Panax24_contig00002476
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00002476 (384 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value NP_001312701.1 14-3-3-like protein D [Nicotiana tabacum] O49996.... 40 4e-06 >NP_001312701.1 14-3-3-like protein D [Nicotiana tabacum] O49996.1 RecName: Full=14-3-3-like protein D AAC49893.1 14-3-3 isoform d [Nicotiana tabacum] BAD10942.1 14-3-3 protein [Nicotiana tabacum] BAD12173.1 14-3-3 d-1 protein [Nicotiana tabacum] Length = 249 Score = 40.0 bits (92), Expect(2) = 4e-06 Identities = 22/32 (68%), Positives = 25/32 (78%), Gaps = 2/32 (6%) Frame = +3 Query: 258 SANRIVD*AEEK--GRKNEEHVALVKEYRSKV 347 +A RIV E+K GRKNEEHV LVK+YRSKV Sbjct: 65 AAWRIVSSIEQKEEGRKNEEHVVLVKDYRSKV 96 Score = 37.7 bits (86), Expect(2) = 4e-06 Identities = 19/29 (65%), Positives = 24/29 (82%) Frame = +2 Query: 158 LLALSRASELTVEDQNLLFVAYKNFIDLL 244 L+A+S +SELTVE++NLL VAYKN I L Sbjct: 35 LVAVSASSELTVEERNLLSVAYKNVIGSL 63