BLASTX nr result
ID: Panax24_contig00002305
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00002305 (659 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007206183.1 hypothetical protein PRUPE_ppa013857mg [Prunus pe... 86 3e-18 XP_009124957.1 PREDICTED: hydrophobic protein RCI2B-like [Brassi... 81 7e-17 XP_009123629.1 PREDICTED: hydrophobic protein RCI2A [Brassica ra... 80 2e-16 XP_006408016.1 hypothetical protein EUTSA_v10021895mg [Eutrema s... 79 3e-16 XP_013622833.1 PREDICTED: hydrophobic protein RCI2A [Brassica ol... 79 4e-16 XP_017244642.1 PREDICTED: hydrophobic protein RCI2A [Daucus caro... 79 4e-16 XP_018488823.1 PREDICTED: hydrophobic protein RCI2A [Raphanus sa... 78 8e-16 XP_006408015.1 hypothetical protein EUTSA_v10021802mg [Eutrema s... 79 1e-15 XP_009134854.1 PREDICTED: hydrophobic protein RCI2A-like [Brassi... 77 2e-15 XP_019093512.1 PREDICTED: hydrophobic protein RCI2B-like [Cameli... 77 2e-15 XP_008246327.1 PREDICTED: hydrophobic protein RCI2B [Prunus mume... 77 2e-15 XP_012859017.1 PREDICTED: hydrophobic protein RCI2B [Erythranthe... 77 2e-15 NP_187240.1 Low temperature and salt responsive protein family [... 77 2e-15 XP_006298933.1 hypothetical protein CARUB_v10015055mg [Capsella ... 77 2e-15 XP_002884538.1 predicted protein [Arabidopsis lyrata subsp. lyra... 77 2e-15 AAF26091.1 low temperature and salt responsive protein LTI6B [Ar... 77 3e-15 XP_002884539.1 low temperature and salt responsive protein LTI6B... 77 3e-15 XP_017216505.1 PREDICTED: hydrophobic protein RCI2B [Daucus caro... 77 3e-15 OIW13474.1 hypothetical protein TanjilG_22265 [Lupinus angustifo... 76 4e-15 NP_187239.1 Low temperature and salt responsive protein family [... 76 4e-15 >XP_007206183.1 hypothetical protein PRUPE_ppa013857mg [Prunus persica] Length = 93 Score = 85.5 bits (210), Expect = 3e-18 Identities = 38/64 (59%), Positives = 47/64 (73%) Frame = -2 Query: 517 KKENKEGKMRHGTATFXXXXXXXXXXXLGVFLRFGCEVEFWICLVLTLLGYLPGILYALY 338 KK+ K+ +R GTATF LGVFL+FGCE EFWICL+LTL GYLPGI+YA+Y Sbjct: 30 KKKTKQNSIRMGTATFVDIIIAILLPPLGVFLKFGCEAEFWICLILTLFGYLPGIIYAIY 89 Query: 337 VITK 326 ++TK Sbjct: 90 ILTK 93 >XP_009124957.1 PREDICTED: hydrophobic protein RCI2B-like [Brassica rapa] XP_013624669.1 PREDICTED: hydrophobic protein RCI2B-like [Brassica oleracea var. oleracea] XP_013647899.1 PREDICTED: hydrophobic protein RCI2B-like [Brassica napus] XP_013725411.1 PREDICTED: hydrophobic protein RCI2B-like [Brassica napus] XP_018441126.1 PREDICTED: hydrophobic protein RCI2B-like [Raphanus sativus] Length = 54 Score = 80.9 bits (198), Expect = 7e-17 Identities = 39/53 (73%), Positives = 41/53 (77%) Frame = -2 Query: 484 GTATFXXXXXXXXXXXLGVFLRFGCEVEFWICLVLTLLGYLPGILYALYVITK 326 GTATF LGVFLR+GCEVEFWICLVLTL GYLPGILYALYV+TK Sbjct: 2 GTATFIDILLAILLPPLGVFLRYGCEVEFWICLVLTLFGYLPGILYALYVLTK 54 >XP_009123629.1 PREDICTED: hydrophobic protein RCI2A [Brassica rapa] XP_013638433.1 PREDICTED: hydrophobic protein RCI2A-like [Brassica oleracea var. oleracea] XP_013692999.1 PREDICTED: hydrophobic protein RCI2A-like [Brassica napus] XP_018493382.1 PREDICTED: hydrophobic protein RCI2A-like [Raphanus sativus] XP_018493383.1 PREDICTED: hydrophobic protein RCI2A-like [Raphanus sativus] CDY05209.1 BnaC05g45940D [Brassica napus] Length = 54 Score = 79.7 bits (195), Expect = 2e-16 Identities = 39/53 (73%), Positives = 41/53 (77%) Frame = -2 Query: 484 GTATFXXXXXXXXXXXLGVFLRFGCEVEFWICLVLTLLGYLPGILYALYVITK 326 GTATF LGVFLR+GC VEFWICLVLTLLGYLPGILYALYV+TK Sbjct: 2 GTATFIDILLAILLPPLGVFLRYGCGVEFWICLVLTLLGYLPGILYALYVLTK 54 >XP_006408016.1 hypothetical protein EUTSA_v10021895mg [Eutrema salsugineum] ESQ49469.1 hypothetical protein EUTSA_v10021895mg [Eutrema salsugineum] Length = 54 Score = 79.3 bits (194), Expect = 3e-16 Identities = 39/53 (73%), Positives = 40/53 (75%) Frame = -2 Query: 484 GTATFXXXXXXXXXXXLGVFLRFGCEVEFWICLVLTLLGYLPGILYALYVITK 326 GTATF LGVFLRFGC VEFWICLVLTL GYLPGILYALYV+TK Sbjct: 2 GTATFIDILLAILLPPLGVFLRFGCGVEFWICLVLTLFGYLPGILYALYVLTK 54 >XP_013622833.1 PREDICTED: hydrophobic protein RCI2A [Brassica oleracea var. oleracea] XP_013622834.1 PREDICTED: hydrophobic protein RCI2A [Brassica oleracea var. oleracea] XP_013684481.1 PREDICTED: hydrophobic protein RCI2A [Brassica napus] XP_013684482.1 PREDICTED: hydrophobic protein RCI2A [Brassica napus] XP_013684483.1 PREDICTED: hydrophobic protein RCI2A [Brassica napus] CDY49984.1 BnaC03g34410D [Brassica napus] Length = 54 Score = 79.0 bits (193), Expect = 4e-16 Identities = 38/53 (71%), Positives = 41/53 (77%) Frame = -2 Query: 484 GTATFXXXXXXXXXXXLGVFLRFGCEVEFWICLVLTLLGYLPGILYALYVITK 326 GTATF LGVFLR+GC VEFWICLVLTLLGYLPGI+YALYV+TK Sbjct: 2 GTATFIDILLAILLPPLGVFLRYGCGVEFWICLVLTLLGYLPGIIYALYVLTK 54 >XP_017244642.1 PREDICTED: hydrophobic protein RCI2A [Daucus carota subsp. sativus] KZM96817.1 hypothetical protein DCAR_015821 [Daucus carota subsp. sativus] Length = 56 Score = 79.0 bits (193), Expect = 4e-16 Identities = 36/56 (64%), Positives = 42/56 (75%) Frame = -2 Query: 493 MRHGTATFXXXXXXXXXXXLGVFLRFGCEVEFWICLVLTLLGYLPGILYALYVITK 326 M+ GTATF LGVFL+FGC VEFWICL+LT LGY+PGI+YA+YVITK Sbjct: 1 MKEGTATFIDIILAIILPPLGVFLKFGCHVEFWICLLLTFLGYIPGIIYAIYVITK 56 >XP_018488823.1 PREDICTED: hydrophobic protein RCI2A [Raphanus sativus] XP_018463797.1 PREDICTED: hydrophobic protein RCI2A [Raphanus sativus] Length = 54 Score = 78.2 bits (191), Expect = 8e-16 Identities = 37/53 (69%), Positives = 41/53 (77%) Frame = -2 Query: 484 GTATFXXXXXXXXXXXLGVFLRFGCEVEFWICLVLTLLGYLPGILYALYVITK 326 GTATF LGVFLR+GC VEFWICLVLTLLGY+PGI+YALYV+TK Sbjct: 2 GTATFIDILLAILLPPLGVFLRYGCGVEFWICLVLTLLGYIPGIIYALYVLTK 54 >XP_006408015.1 hypothetical protein EUTSA_v10021802mg [Eutrema salsugineum] ESQ49468.1 hypothetical protein EUTSA_v10021802mg [Eutrema salsugineum] Length = 111 Score = 79.3 bits (194), Expect = 1e-15 Identities = 36/56 (64%), Positives = 43/56 (76%) Frame = -2 Query: 493 MRHGTATFXXXXXXXXXXXLGVFLRFGCEVEFWICLVLTLLGYLPGILYALYVITK 326 ++ GTATF LGVFL+FGC++EFWICL+LTLLGYLPGI+YALY ITK Sbjct: 55 LKMGTATFVEIILAIILPPLGVFLKFGCKIEFWICLILTLLGYLPGIIYALYAITK 110 >XP_009134854.1 PREDICTED: hydrophobic protein RCI2A-like [Brassica rapa] XP_009134855.1 PREDICTED: hydrophobic protein RCI2A-like [Brassica rapa] XP_013735929.1 PREDICTED: hydrophobic protein RCI2A-like [Brassica napus] XP_013735930.1 PREDICTED: hydrophobic protein RCI2A-like [Brassica napus] Length = 54 Score = 77.4 bits (189), Expect = 2e-15 Identities = 37/53 (69%), Positives = 41/53 (77%) Frame = -2 Query: 484 GTATFXXXXXXXXXXXLGVFLRFGCEVEFWICLVLTLLGYLPGILYALYVITK 326 GTATF LGVFLR+GC VEFWICLVLTLLGYLPGI+YAL+V+TK Sbjct: 2 GTATFIDILLAILLPPLGVFLRYGCGVEFWICLVLTLLGYLPGIIYALFVLTK 54 >XP_019093512.1 PREDICTED: hydrophobic protein RCI2B-like [Camelina sativa] XP_019091984.1 PREDICTED: hydrophobic protein RCI2B-like [Camelina sativa] XP_019096126.1 PREDICTED: hydrophobic protein RCI2B-like [Camelina sativa] Length = 54 Score = 77.0 bits (188), Expect = 2e-15 Identities = 36/52 (69%), Positives = 40/52 (76%) Frame = -2 Query: 481 TATFXXXXXXXXXXXLGVFLRFGCEVEFWICLVLTLLGYLPGILYALYVITK 326 TATF LGVFL+FGC+VEFWICL+LTL GYLPGILYALY+ITK Sbjct: 3 TATFVEILLAILLPPLGVFLKFGCKVEFWICLILTLFGYLPGILYALYIITK 54 >XP_008246327.1 PREDICTED: hydrophobic protein RCI2B [Prunus mume] ONI04114.1 hypothetical protein PRUPE_6G303600 [Prunus persica] Length = 54 Score = 77.0 bits (188), Expect = 2e-15 Identities = 34/53 (64%), Positives = 40/53 (75%) Frame = -2 Query: 484 GTATFXXXXXXXXXXXLGVFLRFGCEVEFWICLVLTLLGYLPGILYALYVITK 326 GTATF LGVFL+FGCE EFWICL+LTL GYLPGI+YA+Y++TK Sbjct: 2 GTATFVDIIIAILLPPLGVFLKFGCEAEFWICLILTLFGYLPGIIYAIYILTK 54 >XP_012859017.1 PREDICTED: hydrophobic protein RCI2B [Erythranthe guttata] EYU19377.1 hypothetical protein MIMGU_mgv1a0175922mg [Erythranthe guttata] Length = 54 Score = 77.0 bits (188), Expect = 2e-15 Identities = 36/53 (67%), Positives = 40/53 (75%) Frame = -2 Query: 484 GTATFXXXXXXXXXXXLGVFLRFGCEVEFWICLVLTLLGYLPGILYALYVITK 326 G+ATF LGVFL+FGCEVEFWICLVLTL GYLPGI+YA+Y ITK Sbjct: 2 GSATFVDIIVAILLPPLGVFLKFGCEVEFWICLVLTLFGYLPGIIYAIYAITK 54 >NP_187240.1 Low temperature and salt responsive protein family [Arabidopsis thaliana] Q9ZNS6.1 RecName: Full=Hydrophobic protein RCI2B; AltName: Full=Low temperature and salt-responsive protein LTI6B AAF23227.1 low temperature and salt responsive protein (LTI6B) [Arabidopsis thaliana] AAK50618.1 hydrophobic protein RCI2B [Arabidopsis thaliana] AAC97511.1 low temperature and salt responsive protein LTI6B [Arabidopsis thaliana] AAD17303.1 hydrophobic protein [Arabidopsis thaliana] AAM61275.1 hydrophobic protein RCI2B (Low temperature and salt responsive protein LTI6B) [Arabidopsis thaliana] BAD44016.1 low temperature and salt responsive protein LTI6B [Arabidopsis thaliana] ABG25095.1 At3g05890 [Arabidopsis thaliana] BAF00618.1 low temperature and salt responsive protein LTI6B [Arabidopsis thaliana] AEE74312.1 Low temperature and salt responsive protein family [Arabidopsis thaliana] OAP04511.1 RCI2B [Arabidopsis thaliana] Length = 54 Score = 77.0 bits (188), Expect = 2e-15 Identities = 36/52 (69%), Positives = 40/52 (76%) Frame = -2 Query: 481 TATFXXXXXXXXXXXLGVFLRFGCEVEFWICLVLTLLGYLPGILYALYVITK 326 TATF LGVFL+FGC+VEFWICL+LTL GYLPGILYALY+ITK Sbjct: 3 TATFVEIILAIILPPLGVFLKFGCKVEFWICLILTLFGYLPGILYALYIITK 54 >XP_006298933.1 hypothetical protein CARUB_v10015055mg [Capsella rubella] EOA31831.1 hypothetical protein CARUB_v10015055mg [Capsella rubella] Length = 54 Score = 77.0 bits (188), Expect = 2e-15 Identities = 36/52 (69%), Positives = 40/52 (76%) Frame = -2 Query: 481 TATFXXXXXXXXXXXLGVFLRFGCEVEFWICLVLTLLGYLPGILYALYVITK 326 TATF LGVFL+FGC+VEFWICL+LTL GYLPGILYALY+ITK Sbjct: 3 TATFVEILLAILLPPLGVFLKFGCKVEFWICLILTLFGYLPGILYALYIITK 54 >XP_002884538.1 predicted protein [Arabidopsis lyrata subsp. lyrata] EFH60797.1 predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 54 Score = 77.0 bits (188), Expect = 2e-15 Identities = 38/53 (71%), Positives = 40/53 (75%) Frame = -2 Query: 484 GTATFXXXXXXXXXXXLGVFLRFGCEVEFWICLVLTLLGYLPGILYALYVITK 326 GTAT LGVFLRFGC VEFWICLVLTLLGY+PGILYALYV+TK Sbjct: 2 GTATCVDIIIAILLPPLGVFLRFGCGVEFWICLVLTLLGYIPGILYALYVLTK 54 >AAF26091.1 low temperature and salt responsive protein LTI6B [Arabidopsis thaliana] Length = 67 Score = 77.0 bits (188), Expect = 3e-15 Identities = 36/52 (69%), Positives = 40/52 (76%) Frame = -2 Query: 481 TATFXXXXXXXXXXXLGVFLRFGCEVEFWICLVLTLLGYLPGILYALYVITK 326 TATF LGVFL+FGC+VEFWICL+LTL GYLPGILYALY+ITK Sbjct: 3 TATFVEIILAIILPPLGVFLKFGCKVEFWICLILTLFGYLPGILYALYIITK 54 >XP_002884539.1 low temperature and salt responsive protein LTI6B [Arabidopsis lyrata subsp. lyrata] EFH60798.1 low temperature and salt responsive protein LTI6B [Arabidopsis lyrata subsp. lyrata] Length = 67 Score = 77.0 bits (188), Expect = 3e-15 Identities = 36/52 (69%), Positives = 40/52 (76%) Frame = -2 Query: 481 TATFXXXXXXXXXXXLGVFLRFGCEVEFWICLVLTLLGYLPGILYALYVITK 326 TATF LGVFL+FGC+VEFWICL+LTL GYLPGILYALY+ITK Sbjct: 3 TATFVEIILAIILPPLGVFLKFGCKVEFWICLILTLFGYLPGILYALYIITK 54 >XP_017216505.1 PREDICTED: hydrophobic protein RCI2B [Daucus carota subsp. sativus] KZM88233.1 hypothetical protein DCAR_025308 [Daucus carota subsp. sativus] Length = 54 Score = 76.6 bits (187), Expect = 3e-15 Identities = 37/53 (69%), Positives = 40/53 (75%) Frame = -2 Query: 484 GTATFXXXXXXXXXXXLGVFLRFGCEVEFWICLVLTLLGYLPGILYALYVITK 326 GTATF LGVFLRF C+VEFWICL+LT LGYLPGILYALYV+TK Sbjct: 2 GTATFVEIILAIILPPLGVFLRFECQVEFWICLLLTFLGYLPGILYALYVLTK 54 >OIW13474.1 hypothetical protein TanjilG_22265 [Lupinus angustifolius] Length = 54 Score = 76.3 bits (186), Expect = 4e-15 Identities = 36/52 (69%), Positives = 39/52 (75%) Frame = -2 Query: 481 TATFXXXXXXXXXXXLGVFLRFGCEVEFWICLVLTLLGYLPGILYALYVITK 326 TATF LGVFLRFGCEVEFWICLVLT LGY+PGI+YA+Y ITK Sbjct: 3 TATFVDIILAVILPPLGVFLRFGCEVEFWICLVLTFLGYIPGIIYAVYAITK 54 >NP_187239.1 Low temperature and salt responsive protein family [Arabidopsis thaliana] Q9ZNQ7.1 RecName: Full=Hydrophobic protein RCI2A; AltName: Full=Low temperature and salt-responsive protein LTI6A AAF26090.1 low temperature and salt responsive protein LTI6A [Arabidopsis thaliana] AAK50619.1 hydrophobic protein RCI2A [Arabidopsis thaliana] AAC97512.1 low temperature and salt responsive protein LTI6A [Arabidopsis thaliana] AAD17302.1 hydrophobic protein [Arabidopsis thaliana] AAK59845.1 AT3g05880/F10A16_18 [Arabidopsis thaliana] AAK63963.1 AT3g05880/F10A16_18 [Arabidopsis thaliana] AAL76128.1 AT3g05880/F10A16_18 [Arabidopsis thaliana] AEE74311.1 Low temperature and salt responsive protein family [Arabidopsis thaliana] OAP02097.1 RCI2A [Arabidopsis thaliana] Length = 54 Score = 76.3 bits (186), Expect = 4e-15 Identities = 36/52 (69%), Positives = 40/52 (76%) Frame = -2 Query: 481 TATFXXXXXXXXXXXLGVFLRFGCEVEFWICLVLTLLGYLPGILYALYVITK 326 TATF LGVFLRFGC VEFWICLVLTLLGY+PGI+YA+YV+TK Sbjct: 3 TATFVDIIIAILLPPLGVFLRFGCGVEFWICLVLTLLGYIPGIIYAIYVLTK 54