BLASTX nr result
ID: Panax24_contig00002179
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00002179 (393 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010242460.1 PREDICTED: acetolactate synthase small subunit 2,... 85 1e-16 KDO77101.1 hypothetical protein CISIN_1g0114912mg, partial [Citr... 79 2e-16 XP_009123667.1 PREDICTED: acetolactate synthase small subunit 2,... 78 3e-16 KJB78879.1 hypothetical protein B456_013G024000 [Gossypium raimo... 81 5e-16 XP_017236772.1 PREDICTED: acetolactate synthase small subunit 1,... 82 8e-16 XP_009406425.1 PREDICTED: acetolactate synthase small subunit 2,... 82 8e-16 BAT13467.1 Os11g0256000, partial [Oryza sativa Japonica Group] 77 1e-15 BAF27995.2 Os11g0256000, partial [Oryza sativa Japonica Group] 77 1e-15 XP_017180025.1 PREDICTED: acetolactate synthase small subunit 2,... 78 1e-15 AQK53502.1 Acetolactate synthase/ amino acid binding protein [Ze... 74 2e-15 XP_016729743.1 PREDICTED: acetolactate synthase small subunit 1,... 81 2e-15 XP_017616908.1 PREDICTED: acetolactate synthase small subunit 1,... 81 3e-15 XP_016703653.1 PREDICTED: acetolactate synthase small subunit 1,... 81 3e-15 XP_016729742.1 PREDICTED: acetolactate synthase small subunit 1,... 81 3e-15 XP_012464981.1 PREDICTED: acetolactate synthase small subunit 1,... 81 3e-15 XP_015058906.1 PREDICTED: acetolactate synthase small subunit 1,... 81 3e-15 XP_016550402.1 PREDICTED: acetolactate synthase small subunit 1,... 81 3e-15 XP_004250085.1 PREDICTED: acetolactate synthase small subunit 1,... 81 3e-15 KHG18039.1 Acetolactate synthase small subunit [Gossypium arboreum] 81 3e-15 OAY62968.1 Acetolactate synthase small subunit 2, chloroplastic ... 80 3e-15 >XP_010242460.1 PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like [Nelumbo nucifera] Length = 482 Score = 84.7 bits (208), Expect = 1e-16 Identities = 40/44 (90%), Positives = 44/44 (100%) Frame = +2 Query: 2 EKMLALQRLLEPYGICEVARTGRVALLRESGVNSTYLRGYSLPF 133 +KM+ALQRLLEPYGICEVARTGRVAL+RESGV+STYLRGYSLPF Sbjct: 439 DKMVALQRLLEPYGICEVARTGRVALVRESGVDSTYLRGYSLPF 482 >KDO77101.1 hypothetical protein CISIN_1g0114912mg, partial [Citrus sinensis] Length = 100 Score = 78.6 bits (192), Expect = 2e-16 Identities = 37/42 (88%), Positives = 41/42 (97%) Frame = +2 Query: 5 KMLALQRLLEPYGICEVARTGRVALLRESGVNSTYLRGYSLP 130 K++ALQRLLEPYGICEVARTGRVAL+RESGV+STYLRGY LP Sbjct: 58 KIIALQRLLEPYGICEVARTGRVALVRESGVDSTYLRGYPLP 99 >XP_009123667.1 PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like [Brassica rapa] Length = 96 Score = 77.8 bits (190), Expect = 3e-16 Identities = 37/43 (86%), Positives = 40/43 (93%) Frame = +2 Query: 2 EKMLALQRLLEPYGICEVARTGRVALLRESGVNSTYLRGYSLP 130 +KM+ALQRLLEPYGICEVARTGRVAL RESGV+S YLRGYS P Sbjct: 51 DKMVALQRLLEPYGICEVARTGRVALARESGVDSKYLRGYSFP 93 >KJB78879.1 hypothetical protein B456_013G024000 [Gossypium raimondii] Length = 249 Score = 80.9 bits (198), Expect = 5e-16 Identities = 38/43 (88%), Positives = 42/43 (97%) Frame = +2 Query: 5 KMLALQRLLEPYGICEVARTGRVALLRESGVNSTYLRGYSLPF 133 KM+ALQ+LLEPYGICEVARTGRVAL+RESGV+STYLRGY LPF Sbjct: 207 KMVALQKLLEPYGICEVARTGRVALVRESGVDSTYLRGYPLPF 249 >XP_017236772.1 PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like [Daucus carota subsp. sativus] KZN04666.1 hypothetical protein DCAR_005503 [Daucus carota subsp. sativus] Length = 482 Score = 82.4 bits (202), Expect = 8e-16 Identities = 40/44 (90%), Positives = 42/44 (95%) Frame = +2 Query: 2 EKMLALQRLLEPYGICEVARTGRVALLRESGVNSTYLRGYSLPF 133 EKMLALQ+LLE YGICEVARTGRVAL+RESGVNS YLRGYSLPF Sbjct: 439 EKMLALQKLLETYGICEVARTGRVALVRESGVNSKYLRGYSLPF 482 >XP_009406425.1 PREDICTED: acetolactate synthase small subunit 2, chloroplastic [Musa acuminata subsp. malaccensis] Length = 487 Score = 82.4 bits (202), Expect = 8e-16 Identities = 39/44 (88%), Positives = 43/44 (97%) Frame = +2 Query: 2 EKMLALQRLLEPYGICEVARTGRVALLRESGVNSTYLRGYSLPF 133 +KM+ALQRLLEPYGICEVARTGRVAL+RESGV+S YLRGYSLPF Sbjct: 444 DKMVALQRLLEPYGICEVARTGRVALVRESGVDSKYLRGYSLPF 487 >BAT13467.1 Os11g0256000, partial [Oryza sativa Japonica Group] Length = 108 Score = 76.6 bits (187), Expect = 1e-15 Identities = 36/43 (83%), Positives = 41/43 (95%) Frame = +2 Query: 2 EKMLALQRLLEPYGICEVARTGRVALLRESGVNSTYLRGYSLP 130 +KM+ALQR+LEPYGICEVARTGRVAL RESGV+S YLRG+SLP Sbjct: 65 DKMVALQRMLEPYGICEVARTGRVALRRESGVDSKYLRGFSLP 107 >BAF27995.2 Os11g0256000, partial [Oryza sativa Japonica Group] Length = 108 Score = 76.6 bits (187), Expect = 1e-15 Identities = 36/43 (83%), Positives = 41/43 (95%) Frame = +2 Query: 2 EKMLALQRLLEPYGICEVARTGRVALLRESGVNSTYLRGYSLP 130 +KM+ALQR+LEPYGICEVARTGRVAL RESGV+S YLRG+SLP Sbjct: 65 DKMVALQRMLEPYGICEVARTGRVALRRESGVDSKYLRGFSLP 107 >XP_017180025.1 PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like [Malus domestica] Length = 166 Score = 78.2 bits (191), Expect = 1e-15 Identities = 36/43 (83%), Positives = 41/43 (95%) Frame = +2 Query: 2 EKMLALQRLLEPYGICEVARTGRVALLRESGVNSTYLRGYSLP 130 +KM+ALQRLLEPYGICEVARTGR+AL+RESGV+S YLRGYS P Sbjct: 123 DKMVALQRLLEPYGICEVARTGRIALVRESGVDSKYLRGYSFP 165 >AQK53502.1 Acetolactate synthase/ amino acid binding protein [Zea mays] Length = 42 Score = 74.3 bits (181), Expect = 2e-15 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = +2 Query: 8 MLALQRLLEPYGICEVARTGRVALLRESGVNSTYLRGYSLP 130 M+ALQRLLEPYGICEVARTGRVAL+RES V+S YLRGYSLP Sbjct: 1 MVALQRLLEPYGICEVARTGRVALVRESKVDSKYLRGYSLP 41 >XP_016729743.1 PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like isoform X2 [Gossypium hirsutum] Length = 432 Score = 80.9 bits (198), Expect = 2e-15 Identities = 38/43 (88%), Positives = 42/43 (97%) Frame = +2 Query: 5 KMLALQRLLEPYGICEVARTGRVALLRESGVNSTYLRGYSLPF 133 KM+ALQ+LLEPYGICEVARTGRVAL+RESGV+STYLRGY LPF Sbjct: 390 KMVALQKLLEPYGICEVARTGRVALVRESGVDSTYLRGYPLPF 432 >XP_017616908.1 PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like [Gossypium arboreum] Length = 483 Score = 80.9 bits (198), Expect = 3e-15 Identities = 38/43 (88%), Positives = 42/43 (97%) Frame = +2 Query: 5 KMLALQRLLEPYGICEVARTGRVALLRESGVNSTYLRGYSLPF 133 KM+ALQ+LLEPYGICEVARTGRVAL+RESGV+STYLRGY LPF Sbjct: 441 KMVALQKLLEPYGICEVARTGRVALVRESGVDSTYLRGYPLPF 483 >XP_016703653.1 PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like [Gossypium hirsutum] Length = 483 Score = 80.9 bits (198), Expect = 3e-15 Identities = 38/43 (88%), Positives = 42/43 (97%) Frame = +2 Query: 5 KMLALQRLLEPYGICEVARTGRVALLRESGVNSTYLRGYSLPF 133 KM+ALQ+LLEPYGICEVARTGRVAL+RESGV+STYLRGY LPF Sbjct: 441 KMVALQKLLEPYGICEVARTGRVALVRESGVDSTYLRGYPLPF 483 >XP_016729742.1 PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like isoform X1 [Gossypium hirsutum] Length = 483 Score = 80.9 bits (198), Expect = 3e-15 Identities = 38/43 (88%), Positives = 42/43 (97%) Frame = +2 Query: 5 KMLALQRLLEPYGICEVARTGRVALLRESGVNSTYLRGYSLPF 133 KM+ALQ+LLEPYGICEVARTGRVAL+RESGV+STYLRGY LPF Sbjct: 441 KMVALQKLLEPYGICEVARTGRVALVRESGVDSTYLRGYPLPF 483 >XP_012464981.1 PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like [Gossypium raimondii] KJB78878.1 hypothetical protein B456_013G024000 [Gossypium raimondii] Length = 483 Score = 80.9 bits (198), Expect = 3e-15 Identities = 38/43 (88%), Positives = 42/43 (97%) Frame = +2 Query: 5 KMLALQRLLEPYGICEVARTGRVALLRESGVNSTYLRGYSLPF 133 KM+ALQ+LLEPYGICEVARTGRVAL+RESGV+STYLRGY LPF Sbjct: 441 KMVALQKLLEPYGICEVARTGRVALVRESGVDSTYLRGYPLPF 483 >XP_015058906.1 PREDICTED: acetolactate synthase small subunit 1, chloroplastic [Solanum pennellii] Length = 486 Score = 80.9 bits (198), Expect = 3e-15 Identities = 38/42 (90%), Positives = 42/42 (100%) Frame = +2 Query: 5 KMLALQRLLEPYGICEVARTGRVALLRESGVNSTYLRGYSLP 130 K+LALQRLLEPYGICEVARTGRVAL+RESGV+STYLRGY+LP Sbjct: 444 KLLALQRLLEPYGICEVARTGRVALIRESGVDSTYLRGYALP 485 >XP_016550402.1 PREDICTED: acetolactate synthase small subunit 1, chloroplastic [Capsicum annuum] Length = 489 Score = 80.9 bits (198), Expect = 3e-15 Identities = 38/42 (90%), Positives = 42/42 (100%) Frame = +2 Query: 5 KMLALQRLLEPYGICEVARTGRVALLRESGVNSTYLRGYSLP 130 K+LALQRLLEPYGICEVARTGRVAL+RESGV+STYLRGY+LP Sbjct: 447 KLLALQRLLEPYGICEVARTGRVALIRESGVDSTYLRGYALP 488 >XP_004250085.1 PREDICTED: acetolactate synthase small subunit 1, chloroplastic isoform X1 [Solanum lycopersicum] Length = 490 Score = 80.9 bits (198), Expect = 3e-15 Identities = 38/42 (90%), Positives = 42/42 (100%) Frame = +2 Query: 5 KMLALQRLLEPYGICEVARTGRVALLRESGVNSTYLRGYSLP 130 K+LALQRLLEPYGICEVARTGRVAL+RESGV+STYLRGY+LP Sbjct: 448 KLLALQRLLEPYGICEVARTGRVALIRESGVDSTYLRGYALP 489 >KHG18039.1 Acetolactate synthase small subunit [Gossypium arboreum] Length = 499 Score = 80.9 bits (198), Expect = 3e-15 Identities = 38/43 (88%), Positives = 42/43 (97%) Frame = +2 Query: 5 KMLALQRLLEPYGICEVARTGRVALLRESGVNSTYLRGYSLPF 133 KM+ALQ+LLEPYGICEVARTGRVAL+RESGV+STYLRGY LPF Sbjct: 457 KMVALQKLLEPYGICEVARTGRVALVRESGVDSTYLRGYPLPF 499 >OAY62968.1 Acetolactate synthase small subunit 2, chloroplastic [Ananas comosus] Length = 391 Score = 80.5 bits (197), Expect = 3e-15 Identities = 38/43 (88%), Positives = 42/43 (97%) Frame = +2 Query: 2 EKMLALQRLLEPYGICEVARTGRVALLRESGVNSTYLRGYSLP 130 +KM+ALQRLLEPYGICEVARTGRVAL+RESGV+S YLRGYSLP Sbjct: 348 DKMVALQRLLEPYGICEVARTGRVALIRESGVDSKYLRGYSLP 390