BLASTX nr result
ID: Panax24_contig00001595
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00001595 (498 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KGN43564.1 hypothetical protein Csa_7G045530 [Cucumis sativus] 70 4e-13 >KGN43564.1 hypothetical protein Csa_7G045530 [Cucumis sativus] Length = 80 Score = 70.5 bits (171), Expect = 4e-13 Identities = 36/58 (62%), Positives = 43/58 (74%) Frame = -3 Query: 400 QRSSFSLAAATKLNCSHTSKWVWGDNERVTFLCVLRRSRSSYIWRLCRVSEGLSLDYG 227 +++ F+LAAAT S T KWVW + V L VLR+SRSS+IWRLCRV EGLSLDYG Sbjct: 25 KKTPFTLAAATSSKSSRTFKWVWDNG--VISLGVLRKSRSSHIWRLCRVLEGLSLDYG 80