BLASTX nr result
ID: Panax24_contig00001438
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00001438 (576 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_008354622.1 PREDICTED: 26S proteasome non-ATPase regulatory s... 97 3e-20 KHN41889.1 26S proteasome non-ATPase regulatory subunit 4 [Glyci... 95 5e-20 XP_016569395.1 PREDICTED: 26S proteasome non-ATPase regulatory s... 89 1e-19 KRH28809.1 hypothetical protein GLYMA_11G078100 [Glycine max] 95 2e-19 XP_008440835.1 PREDICTED: 26S proteasome non-ATPase regulatory s... 94 2e-19 XP_004134856.1 PREDICTED: 26S proteasome non-ATPase regulatory s... 94 2e-19 OAY57944.1 hypothetical protein MANES_02G137100 [Manihot esculenta] 94 2e-19 ONH97111.1 hypothetical protein PRUPE_7G170300 [Prunus persica] 94 2e-19 NP_001242422.1 uncharacterized protein LOC100803975 [Glycine max... 94 2e-19 XP_007202064.1 hypothetical protein PRUPE_ppa005827mg [Prunus pe... 94 3e-19 XP_017408428.1 PREDICTED: 26S proteasome non-ATPase regulatory s... 94 4e-19 XP_017408427.1 PREDICTED: 26S proteasome non-ATPase regulatory s... 94 4e-19 XP_017408426.1 PREDICTED: 26S proteasome non-ATPase regulatory s... 94 4e-19 XP_009379380.1 PREDICTED: 26S proteasome non-ATPase regulatory s... 94 4e-19 XP_017408425.1 PREDICTED: 26S proteasome non-ATPase regulatory s... 94 4e-19 KOM28078.1 hypothetical protein LR48_Vigan499s002200, partial [V... 94 4e-19 XP_019229271.1 PREDICTED: 26S proteasome non-ATPase regulatory s... 93 5e-19 XP_016488035.1 PREDICTED: 26S proteasome non-ATPase regulatory s... 93 5e-19 XP_009591888.1 PREDICTED: 26S proteasome non-ATPase regulatory s... 93 5e-19 XP_009363482.1 PREDICTED: 26S proteasome non-ATPase regulatory s... 93 6e-19 >XP_008354622.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 4 homolog [Malus domestica] Length = 402 Score = 96.7 bits (239), Expect = 3e-20 Identities = 49/55 (89%), Positives = 50/55 (90%) Frame = -1 Query: 576 QLSVQEGAKDQSSQTDMSNLLADQSFVSSILASLPGVDPNDPSVKDLLASMQNPS 412 QLSVQEG KD S+ DMS LLADQSFVSSILASLPGVDPNDPSVKDLLASMQNPS Sbjct: 332 QLSVQEGEKDSDSEKDMSKLLADQSFVSSILASLPGVDPNDPSVKDLLASMQNPS 386 >KHN41889.1 26S proteasome non-ATPase regulatory subunit 4 [Glycine soja] Length = 307 Score = 94.7 bits (234), Expect = 5e-20 Identities = 48/55 (87%), Positives = 51/55 (92%) Frame = -1 Query: 576 QLSVQEGAKDQSSQTDMSNLLADQSFVSSILASLPGVDPNDPSVKDLLASMQNPS 412 QLS+ + AKDQSSQ+DMS LLADQSFVSSILASLPGVDPNDPSVKDLLASMQN S Sbjct: 236 QLSITDSAKDQSSQSDMSKLLADQSFVSSILASLPGVDPNDPSVKDLLASMQNQS 290 >XP_016569395.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 4 homolog [Capsicum annuum] Length = 90 Score = 88.6 bits (218), Expect = 1e-19 Identities = 46/55 (83%), Positives = 48/55 (87%) Frame = -1 Query: 576 QLSVQEGAKDQSSQTDMSNLLADQSFVSSILASLPGVDPNDPSVKDLLASMQNPS 412 QLSVQ+ DQS+QTDMS LLADQSFVSSILASLPGVDPNDPSVKDLLA MQ S Sbjct: 32 QLSVQDSTIDQSNQTDMSKLLADQSFVSSILASLPGVDPNDPSVKDLLAFMQGQS 86 >KRH28809.1 hypothetical protein GLYMA_11G078100 [Glycine max] Length = 405 Score = 94.7 bits (234), Expect = 2e-19 Identities = 48/55 (87%), Positives = 51/55 (92%) Frame = -1 Query: 576 QLSVQEGAKDQSSQTDMSNLLADQSFVSSILASLPGVDPNDPSVKDLLASMQNPS 412 QLS+ + AKDQSSQ+DMS LLADQSFVSSILASLPGVDPNDPSVKDLLASMQN S Sbjct: 334 QLSITDSAKDQSSQSDMSKLLADQSFVSSILASLPGVDPNDPSVKDLLASMQNQS 388 >XP_008440835.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 4 homolog [Cucumis melo] Length = 403 Score = 94.4 bits (233), Expect = 2e-19 Identities = 48/53 (90%), Positives = 50/53 (94%) Frame = -1 Query: 576 QLSVQEGAKDQSSQTDMSNLLADQSFVSSILASLPGVDPNDPSVKDLLASMQN 418 QLSVQEG+ D SSQTDMS LLADQSFVSSILASLPGVDPNDPSVKDLLASMQ+ Sbjct: 334 QLSVQEGSSDSSSQTDMSKLLADQSFVSSILASLPGVDPNDPSVKDLLASMQS 386 >XP_004134856.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 4 homolog [Cucumis sativus] KGN48930.1 hypothetical protein Csa_6G507050 [Cucumis sativus] Length = 403 Score = 94.4 bits (233), Expect = 2e-19 Identities = 48/53 (90%), Positives = 50/53 (94%) Frame = -1 Query: 576 QLSVQEGAKDQSSQTDMSNLLADQSFVSSILASLPGVDPNDPSVKDLLASMQN 418 QLSVQEG+ D SSQTDMS LLADQSFVSSILASLPGVDPNDPSVKDLLASMQ+ Sbjct: 334 QLSVQEGSSDSSSQTDMSKLLADQSFVSSILASLPGVDPNDPSVKDLLASMQS 386 >OAY57944.1 hypothetical protein MANES_02G137100 [Manihot esculenta] Length = 404 Score = 94.4 bits (233), Expect = 2e-19 Identities = 48/55 (87%), Positives = 50/55 (90%) Frame = -1 Query: 576 QLSVQEGAKDQSSQTDMSNLLADQSFVSSILASLPGVDPNDPSVKDLLASMQNPS 412 QLSVQ+G KD SQTDMS LLADQSFVSSILASLPGVDPNDPSVKDLLASMQ+ S Sbjct: 334 QLSVQDGTKDSGSQTDMSKLLADQSFVSSILASLPGVDPNDPSVKDLLASMQSQS 388 >ONH97111.1 hypothetical protein PRUPE_7G170300 [Prunus persica] Length = 405 Score = 94.4 bits (233), Expect = 2e-19 Identities = 49/55 (89%), Positives = 49/55 (89%) Frame = -1 Query: 576 QLSVQEGAKDQSSQTDMSNLLADQSFVSSILASLPGVDPNDPSVKDLLASMQNPS 412 QLSVQE AKD SQ DMS LLADQSFVSSILASLPGVDPNDPSVKDLLASMQN S Sbjct: 334 QLSVQESAKDSGSQKDMSKLLADQSFVSSILASLPGVDPNDPSVKDLLASMQNQS 388 >NP_001242422.1 uncharacterized protein LOC100803975 [Glycine max] ACU20945.1 unknown [Glycine max] Length = 405 Score = 94.4 bits (233), Expect = 2e-19 Identities = 48/55 (87%), Positives = 51/55 (92%) Frame = -1 Query: 576 QLSVQEGAKDQSSQTDMSNLLADQSFVSSILASLPGVDPNDPSVKDLLASMQNPS 412 QLS+ + AKDQSSQ+DMS LLADQSFVSSILASLPGVDPNDPSVKDLLASMQN S Sbjct: 334 QLSITDSAKDQSSQSDMSKLLADQSFVSSILASLPGVDPNDPSVKDLLASMQNRS 388 >XP_007202064.1 hypothetical protein PRUPE_ppa005827mg [Prunus persica] Length = 442 Score = 94.4 bits (233), Expect = 3e-19 Identities = 49/55 (89%), Positives = 49/55 (89%) Frame = -1 Query: 576 QLSVQEGAKDQSSQTDMSNLLADQSFVSSILASLPGVDPNDPSVKDLLASMQNPS 412 QLSVQE AKD SQ DMS LLADQSFVSSILASLPGVDPNDPSVKDLLASMQN S Sbjct: 371 QLSVQESAKDSGSQKDMSKLLADQSFVSSILASLPGVDPNDPSVKDLLASMQNQS 425 >XP_017408428.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 4 homolog isoform X4 [Vigna angularis] Length = 395 Score = 93.6 bits (231), Expect = 4e-19 Identities = 47/55 (85%), Positives = 51/55 (92%) Frame = -1 Query: 576 QLSVQEGAKDQSSQTDMSNLLADQSFVSSILASLPGVDPNDPSVKDLLASMQNPS 412 QLS+ + AKDQ+SQ+DMS LLADQSFVSSILASLPGVDPNDPSVKDLLASMQN S Sbjct: 324 QLSIADSAKDQTSQSDMSKLLADQSFVSSILASLPGVDPNDPSVKDLLASMQNQS 378 >XP_017408427.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 4 homolog isoform X3 [Vigna angularis] Length = 401 Score = 93.6 bits (231), Expect = 4e-19 Identities = 47/55 (85%), Positives = 51/55 (92%) Frame = -1 Query: 576 QLSVQEGAKDQSSQTDMSNLLADQSFVSSILASLPGVDPNDPSVKDLLASMQNPS 412 QLS+ + AKDQ+SQ+DMS LLADQSFVSSILASLPGVDPNDPSVKDLLASMQN S Sbjct: 330 QLSIADSAKDQTSQSDMSKLLADQSFVSSILASLPGVDPNDPSVKDLLASMQNQS 384 >XP_017408426.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 4 homolog isoform X2 [Vigna angularis] Length = 402 Score = 93.6 bits (231), Expect = 4e-19 Identities = 47/55 (85%), Positives = 51/55 (92%) Frame = -1 Query: 576 QLSVQEGAKDQSSQTDMSNLLADQSFVSSILASLPGVDPNDPSVKDLLASMQNPS 412 QLS+ + AKDQ+SQ+DMS LLADQSFVSSILASLPGVDPNDPSVKDLLASMQN S Sbjct: 331 QLSIADSAKDQTSQSDMSKLLADQSFVSSILASLPGVDPNDPSVKDLLASMQNQS 385 >XP_009379380.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 4 homolog [Pyrus x bretschneideri] Length = 402 Score = 93.6 bits (231), Expect = 4e-19 Identities = 48/55 (87%), Positives = 49/55 (89%) Frame = -1 Query: 576 QLSVQEGAKDQSSQTDMSNLLADQSFVSSILASLPGVDPNDPSVKDLLASMQNPS 412 QLSVQEG KD S+ DMS LLADQSFVSSILASLPGVDPNDPSVKDLLASMQN S Sbjct: 332 QLSVQEGEKDSGSEKDMSKLLADQSFVSSILASLPGVDPNDPSVKDLLASMQNQS 386 >XP_017408425.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 4 homolog isoform X1 [Vigna angularis] BAT99970.1 hypothetical protein VIGAN_10151700 [Vigna angularis var. angularis] Length = 403 Score = 93.6 bits (231), Expect = 4e-19 Identities = 47/55 (85%), Positives = 51/55 (92%) Frame = -1 Query: 576 QLSVQEGAKDQSSQTDMSNLLADQSFVSSILASLPGVDPNDPSVKDLLASMQNPS 412 QLS+ + AKDQ+SQ+DMS LLADQSFVSSILASLPGVDPNDPSVKDLLASMQN S Sbjct: 332 QLSIADSAKDQTSQSDMSKLLADQSFVSSILASLPGVDPNDPSVKDLLASMQNQS 386 >KOM28078.1 hypothetical protein LR48_Vigan499s002200, partial [Vigna angularis] Length = 406 Score = 93.6 bits (231), Expect = 4e-19 Identities = 47/55 (85%), Positives = 51/55 (92%) Frame = -1 Query: 576 QLSVQEGAKDQSSQTDMSNLLADQSFVSSILASLPGVDPNDPSVKDLLASMQNPS 412 QLS+ + AKDQ+SQ+DMS LLADQSFVSSILASLPGVDPNDPSVKDLLASMQN S Sbjct: 339 QLSIADSAKDQTSQSDMSKLLADQSFVSSILASLPGVDPNDPSVKDLLASMQNQS 393 >XP_019229271.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 4 homolog [Nicotiana attenuata] OIT06332.1 26s proteasome non-atpase regulatory subunit 4-like protein [Nicotiana attenuata] Length = 400 Score = 93.2 bits (230), Expect = 5e-19 Identities = 48/55 (87%), Positives = 49/55 (89%) Frame = -1 Query: 576 QLSVQEGAKDQSSQTDMSNLLADQSFVSSILASLPGVDPNDPSVKDLLASMQNPS 412 QLSVQ+ DQSSQTDMS LLADQSFVSSILASLPGVDPNDPSVKDLLASMQ S Sbjct: 330 QLSVQDSTNDQSSQTDMSKLLADQSFVSSILASLPGVDPNDPSVKDLLASMQGQS 384 >XP_016488035.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 4 homolog [Nicotiana tabacum] Length = 400 Score = 93.2 bits (230), Expect = 5e-19 Identities = 48/55 (87%), Positives = 49/55 (89%) Frame = -1 Query: 576 QLSVQEGAKDQSSQTDMSNLLADQSFVSSILASLPGVDPNDPSVKDLLASMQNPS 412 QLSVQ+ DQSSQTDMS LLADQSFVSSILASLPGVDPNDPSVKDLLASMQ S Sbjct: 330 QLSVQDSTNDQSSQTDMSKLLADQSFVSSILASLPGVDPNDPSVKDLLASMQGQS 384 >XP_009591888.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 4 homolog [Nicotiana tomentosiformis] XP_018623872.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 4 homolog [Nicotiana tomentosiformis] Length = 400 Score = 93.2 bits (230), Expect = 5e-19 Identities = 48/55 (87%), Positives = 49/55 (89%) Frame = -1 Query: 576 QLSVQEGAKDQSSQTDMSNLLADQSFVSSILASLPGVDPNDPSVKDLLASMQNPS 412 QLSVQ+ DQSSQTDMS LLADQSFVSSILASLPGVDPNDPSVKDLLASMQ S Sbjct: 330 QLSVQDSTNDQSSQTDMSKLLADQSFVSSILASLPGVDPNDPSVKDLLASMQGQS 384 >XP_009363482.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 4 homolog [Pyrus x bretschneideri] Length = 403 Score = 93.2 bits (230), Expect = 6e-19 Identities = 47/55 (85%), Positives = 49/55 (89%) Frame = -1 Query: 576 QLSVQEGAKDQSSQTDMSNLLADQSFVSSILASLPGVDPNDPSVKDLLASMQNPS 412 Q+SVQEG KD S+ DMS LLADQSFVSSILASLPGVDPNDPSVKDLLASMQN S Sbjct: 332 QMSVQEGGKDSGSEKDMSKLLADQSFVSSILASLPGVDPNDPSVKDLLASMQNQS 386