BLASTX nr result
ID: Panax24_contig00001230
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00001230 (489 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM82133.1 hypothetical protein DCAR_031840 [Daucus carota subsp... 148 4e-42 OAY82451.1 Cysteine proteinase inhibitor 12 [Ananas comosus] 148 4e-42 XP_017225530.1 PREDICTED: cysteine proteinase inhibitor 6-like [... 148 1e-41 OAY77484.1 Cysteine proteinase inhibitor 12 [Ananas comosus] 147 2e-41 XP_020087292.1 cysteine proteinase inhibitor 12-like [Ananas com... 147 2e-41 KMT17034.1 hypothetical protein BVRB_2g042350 [Beta vulgaris sub... 146 3e-41 XP_008245659.1 PREDICTED: cysteine proteinase inhibitor 12-like ... 144 5e-41 XP_010670580.1 PREDICTED: cysteine proteinase inhibitor 6 isofor... 146 9e-41 XP_007220532.1 hypothetical protein PRUPE_ppa010412mg [Prunus pe... 145 1e-40 XP_010909027.1 PREDICTED: cysteine proteinase inhibitor 6 [Elaei... 144 4e-40 XP_008445944.1 PREDICTED: cysteine proteinase inhibitor 12 [Cucu... 144 5e-40 XP_010031030.1 PREDICTED: cysteine proteinase inhibitor 12 [Euca... 143 7e-40 KCW50299.1 hypothetical protein EUGRSUZ_J00085 [Eucalyptus grandis] 143 8e-40 XP_004147084.1 PREDICTED: cysteine proteinase inhibitor 12 [Cucu... 142 2e-39 XP_019103585.1 PREDICTED: cysteine proteinase inhibitor 6 isofor... 142 3e-39 XP_008795132.1 PREDICTED: cysteine proteinase inhibitor 12 [Phoe... 142 3e-39 XP_010520100.1 PREDICTED: cysteine proteinase inhibitor 6 [Taren... 140 4e-39 XP_010244435.1 PREDICTED: cysteine proteinase inhibitor 12-like ... 141 4e-39 XP_006471323.1 PREDICTED: cysteine proteinase inhibitor 12 [Citr... 140 1e-38 XP_006432368.1 hypothetical protein CICLE_v10002346mg [Citrus cl... 140 1e-38 >KZM82133.1 hypothetical protein DCAR_031840 [Daucus carota subsp. sativus] Length = 202 Score = 148 bits (373), Expect = 4e-42 Identities = 71/86 (82%), Positives = 77/86 (89%) Frame = -3 Query: 487 FKELQEFKHAGDSPSITPSDLGAKKGGHLPGWQSVPVHDPVVQDAANHAIKTIQQRSNSL 308 FKELQEFKH D PSITPSDLG KKG H GWQSVPVHDPVVQDAA+HAIKTIQQRSNSL Sbjct: 84 FKELQEFKHVEDCPSITPSDLGVKKGDHPVGWQSVPVHDPVVQDAADHAIKTIQQRSNSL 143 Query: 307 LPYELREIIHAKAEVIEESAKFDMLL 230 +PY+L+EI+HA EVIEESAKFD+LL Sbjct: 144 VPYQLQEIVHANVEVIEESAKFDILL 169 >OAY82451.1 Cysteine proteinase inhibitor 12 [Ananas comosus] Length = 203 Score = 148 bits (373), Expect = 4e-42 Identities = 70/86 (81%), Positives = 77/86 (89%) Frame = -3 Query: 487 FKELQEFKHAGDSPSITPSDLGAKKGGHLPGWQSVPVHDPVVQDAANHAIKTIQQRSNSL 308 FKELQEF+HAGDSPS T +DLGAK+GGH GW+ VP HDPVV+DAANHA+KTIQQRSNSL Sbjct: 86 FKELQEFRHAGDSPSFTAADLGAKRGGHESGWRDVPAHDPVVKDAANHAVKTIQQRSNSL 145 Query: 307 LPYELREIIHAKAEVIEESAKFDMLL 230 PYEL EI+HAKAEVIEE AKFDMLL Sbjct: 146 TPYELLEILHAKAEVIEELAKFDMLL 171 >XP_017225530.1 PREDICTED: cysteine proteinase inhibitor 6-like [Daucus carota subsp. sativus] Length = 245 Score = 148 bits (373), Expect = 1e-41 Identities = 71/86 (82%), Positives = 77/86 (89%) Frame = -3 Query: 487 FKELQEFKHAGDSPSITPSDLGAKKGGHLPGWQSVPVHDPVVQDAANHAIKTIQQRSNSL 308 FKELQEFKH D PSITPSDLG KKG H GWQSVPVHDPVVQDAA+HAIKTIQQRSNSL Sbjct: 127 FKELQEFKHVEDCPSITPSDLGVKKGDHPVGWQSVPVHDPVVQDAADHAIKTIQQRSNSL 186 Query: 307 LPYELREIIHAKAEVIEESAKFDMLL 230 +PY+L+EI+HA EVIEESAKFD+LL Sbjct: 187 VPYQLQEIVHANVEVIEESAKFDILL 212 >OAY77484.1 Cysteine proteinase inhibitor 12 [Ananas comosus] Length = 239 Score = 147 bits (372), Expect = 2e-41 Identities = 69/86 (80%), Positives = 77/86 (89%) Frame = -3 Query: 487 FKELQEFKHAGDSPSITPSDLGAKKGGHLPGWQSVPVHDPVVQDAANHAIKTIQQRSNSL 308 FKELQEF+HAGDSPS T +DLGAK+GGH GW+ +P HDPVV+DAANHA+KTIQQRSNSL Sbjct: 122 FKELQEFRHAGDSPSFTAADLGAKRGGHESGWRDIPAHDPVVKDAANHAVKTIQQRSNSL 181 Query: 307 LPYELREIIHAKAEVIEESAKFDMLL 230 PYEL EI+HAKAEVIEE AKFDMLL Sbjct: 182 TPYELLEILHAKAEVIEELAKFDMLL 207 >XP_020087292.1 cysteine proteinase inhibitor 12-like [Ananas comosus] Length = 247 Score = 147 bits (372), Expect = 2e-41 Identities = 69/86 (80%), Positives = 77/86 (89%) Frame = -3 Query: 487 FKELQEFKHAGDSPSITPSDLGAKKGGHLPGWQSVPVHDPVVQDAANHAIKTIQQRSNSL 308 FKELQEF+HAGDSPS T +DLGAK+GGH GW+ +P HDPVV+DAANHA+KTIQQRSNSL Sbjct: 130 FKELQEFRHAGDSPSFTAADLGAKRGGHESGWRDIPAHDPVVKDAANHAVKTIQQRSNSL 189 Query: 307 LPYELREIIHAKAEVIEESAKFDMLL 230 PYEL EI+HAKAEVIEE AKFDMLL Sbjct: 190 TPYELLEILHAKAEVIEELAKFDMLL 215 >KMT17034.1 hypothetical protein BVRB_2g042350 [Beta vulgaris subsp. vulgaris] Length = 205 Score = 146 bits (368), Expect = 3e-41 Identities = 69/86 (80%), Positives = 77/86 (89%) Frame = -3 Query: 487 FKELQEFKHAGDSPSITPSDLGAKKGGHLPGWQSVPVHDPVVQDAANHAIKTIQQRSNSL 308 FKELQEFKHA DSPSITPSDLGA K GH PGW+ VPVHDP VQDAANHA+KTIQQRSNSL Sbjct: 83 FKELQEFKHADDSPSITPSDLGAIKEGHAPGWKEVPVHDPEVQDAANHAVKTIQQRSNSL 142 Query: 307 LPYELREIIHAKAEVIEESAKFDMLL 230 PYEL+EI HAKAEV+E++AKF++ L Sbjct: 143 FPYELQEIAHAKAEVVEDTAKFNLHL 168 >XP_008245659.1 PREDICTED: cysteine proteinase inhibitor 12-like [Prunus mume] Length = 166 Score = 144 bits (363), Expect = 5e-41 Identities = 68/89 (76%), Positives = 79/89 (88%), Gaps = 3/89 (3%) Frame = -3 Query: 487 FKELQEFKHAGD---SPSITPSDLGAKKGGHLPGWQSVPVHDPVVQDAANHAIKTIQQRS 317 FKE+QEFKHAGD +PS TPS+LG K+GGH PGWQSVP HDP VQDAANHA+K++QQRS Sbjct: 45 FKEVQEFKHAGDCNETPSFTPSELGVKEGGHGPGWQSVPPHDPQVQDAANHAVKSLQQRS 104 Query: 316 NSLLPYELREIIHAKAEVIEESAKFDMLL 230 NSL PYEL+E++HAKAEVIEE AKF+MLL Sbjct: 105 NSLFPYELQEVVHAKAEVIEEHAKFNMLL 133 >XP_010670580.1 PREDICTED: cysteine proteinase inhibitor 6 isoform X1 [Beta vulgaris subsp. vulgaris] Length = 250 Score = 146 bits (368), Expect = 9e-41 Identities = 69/86 (80%), Positives = 77/86 (89%) Frame = -3 Query: 487 FKELQEFKHAGDSPSITPSDLGAKKGGHLPGWQSVPVHDPVVQDAANHAIKTIQQRSNSL 308 FKELQEFKHA DSPSITPSDLGA K GH PGW+ VPVHDP VQDAANHA+KTIQQRSNSL Sbjct: 128 FKELQEFKHADDSPSITPSDLGAIKEGHAPGWKEVPVHDPEVQDAANHAVKTIQQRSNSL 187 Query: 307 LPYELREIIHAKAEVIEESAKFDMLL 230 PYEL+EI HAKAEV+E++AKF++ L Sbjct: 188 FPYELQEIAHAKAEVVEDTAKFNLHL 213 >XP_007220532.1 hypothetical protein PRUPE_ppa010412mg [Prunus persica] ONI21038.1 hypothetical protein PRUPE_2G047100 [Prunus persica] Length = 250 Score = 145 bits (367), Expect = 1e-40 Identities = 69/89 (77%), Positives = 79/89 (88%), Gaps = 3/89 (3%) Frame = -3 Query: 487 FKELQEFKHAGD---SPSITPSDLGAKKGGHLPGWQSVPVHDPVVQDAANHAIKTIQQRS 317 FKE+QEFKHAGD +PS TPSDLG K+GGH PGWQSVP HDP VQDAANHA+K++QQRS Sbjct: 129 FKEVQEFKHAGDCNETPSFTPSDLGVKEGGHGPGWQSVPPHDPQVQDAANHAVKSLQQRS 188 Query: 316 NSLLPYELREIIHAKAEVIEESAKFDMLL 230 NSL PYEL+E++HAKAEVIEE AKF+MLL Sbjct: 189 NSLFPYELQEVVHAKAEVIEEHAKFNMLL 217 >XP_010909027.1 PREDICTED: cysteine proteinase inhibitor 6 [Elaeis guineensis] Length = 243 Score = 144 bits (363), Expect = 4e-40 Identities = 68/86 (79%), Positives = 77/86 (89%) Frame = -3 Query: 487 FKELQEFKHAGDSPSITPSDLGAKKGGHLPGWQSVPVHDPVVQDAANHAIKTIQQRSNSL 308 FKELQEF H GDSPS+T +DLGAK GGH PGW++VP HDPVVQ+AANHA+KTIQQRSNSL Sbjct: 122 FKELQEFTHLGDSPSVTAADLGAKHGGHEPGWRTVPAHDPVVQEAANHAVKTIQQRSNSL 181 Query: 307 LPYELREIIHAKAEVIEESAKFDMLL 230 PYEL EI+ AKAEVIE+SAKFD+LL Sbjct: 182 APYELLEILLAKAEVIEDSAKFDLLL 207 >XP_008445944.1 PREDICTED: cysteine proteinase inhibitor 12 [Cucumis melo] Length = 250 Score = 144 bits (363), Expect = 5e-40 Identities = 69/86 (80%), Positives = 77/86 (89%) Frame = -3 Query: 487 FKELQEFKHAGDSPSITPSDLGAKKGGHLPGWQSVPVHDPVVQDAANHAIKTIQQRSNSL 308 FKELQEFKHAGD PSI+PSDLGAKKG H GW+ VP HDP VQDAA HA++TIQQRSNSL Sbjct: 132 FKELQEFKHAGDVPSISPSDLGAKKGDHPQGWREVPPHDPHVQDAAQHALRTIQQRSNSL 191 Query: 307 LPYELREIIHAKAEVIEESAKFDMLL 230 +PYEL EIIHAKAEVIE++AKFD+LL Sbjct: 192 VPYELLEIIHAKAEVIEDAAKFDLLL 217 >XP_010031030.1 PREDICTED: cysteine proteinase inhibitor 12 [Eucalyptus grandis] KCW50300.1 hypothetical protein EUGRSUZ_J00085 [Eucalyptus grandis] Length = 239 Score = 143 bits (361), Expect = 7e-40 Identities = 68/85 (80%), Positives = 73/85 (85%) Frame = -3 Query: 484 KELQEFKHAGDSPSITPSDLGAKKGGHLPGWQSVPVHDPVVQDAANHAIKTIQQRSNSLL 305 KELQEFKHAGD P+ T SDLGA+ GGH PGWQ VPVHDP VQDAA+HA+KTIQQRSNSL Sbjct: 122 KELQEFKHAGDVPAFTSSDLGARIGGHCPGWQEVPVHDPEVQDAADHAVKTIQQRSNSLF 181 Query: 304 PYELREIIHAKAEVIEESAKFDMLL 230 PYEL EI+HAKAEV E AKFDMLL Sbjct: 182 PYELHEIVHAKAEVAENLAKFDMLL 206 >KCW50299.1 hypothetical protein EUGRSUZ_J00085 [Eucalyptus grandis] Length = 240 Score = 143 bits (361), Expect = 8e-40 Identities = 68/85 (80%), Positives = 73/85 (85%) Frame = -3 Query: 484 KELQEFKHAGDSPSITPSDLGAKKGGHLPGWQSVPVHDPVVQDAANHAIKTIQQRSNSLL 305 KELQEFKHAGD P+ T SDLGA+ GGH PGWQ VPVHDP VQDAA+HA+KTIQQRSNSL Sbjct: 123 KELQEFKHAGDVPAFTSSDLGARIGGHCPGWQEVPVHDPEVQDAADHAVKTIQQRSNSLF 182 Query: 304 PYELREIIHAKAEVIEESAKFDMLL 230 PYEL EI+HAKAEV E AKFDMLL Sbjct: 183 PYELHEIVHAKAEVAENLAKFDMLL 207 >XP_004147084.1 PREDICTED: cysteine proteinase inhibitor 12 [Cucumis sativus] KGN51606.1 hypothetical protein Csa_5G583360 [Cucumis sativus] Length = 249 Score = 142 bits (359), Expect = 2e-39 Identities = 69/86 (80%), Positives = 76/86 (88%) Frame = -3 Query: 487 FKELQEFKHAGDSPSITPSDLGAKKGGHLPGWQSVPVHDPVVQDAANHAIKTIQQRSNSL 308 FKELQEFKHAGD PSITPSDLGAKKG H GW+ V HDP VQDAA HA++TIQQRSNSL Sbjct: 131 FKELQEFKHAGDVPSITPSDLGAKKGDHPQGWREVAPHDPHVQDAAQHALRTIQQRSNSL 190 Query: 307 LPYELREIIHAKAEVIEESAKFDMLL 230 +PYEL EIIHAKAEVIE++AKFD+LL Sbjct: 191 VPYELLEIIHAKAEVIEDAAKFDLLL 216 >XP_019103585.1 PREDICTED: cysteine proteinase inhibitor 6 isoform X2 [Beta vulgaris subsp. vulgaris] Length = 249 Score = 142 bits (358), Expect = 3e-39 Identities = 69/86 (80%), Positives = 77/86 (89%) Frame = -3 Query: 487 FKELQEFKHAGDSPSITPSDLGAKKGGHLPGWQSVPVHDPVVQDAANHAIKTIQQRSNSL 308 FKELQEFKHA DSPSITPSDLGA KG H PGW+ VPVHDP VQDAANHA+KTIQQRSNSL Sbjct: 128 FKELQEFKHADDSPSITPSDLGAIKG-HAPGWKEVPVHDPEVQDAANHAVKTIQQRSNSL 186 Query: 307 LPYELREIIHAKAEVIEESAKFDMLL 230 PYEL+EI HAKAEV+E++AKF++ L Sbjct: 187 FPYELQEIAHAKAEVVEDTAKFNLHL 212 >XP_008795132.1 PREDICTED: cysteine proteinase inhibitor 12 [Phoenix dactylifera] Length = 242 Score = 142 bits (357), Expect = 3e-39 Identities = 66/86 (76%), Positives = 78/86 (90%) Frame = -3 Query: 487 FKELQEFKHAGDSPSITPSDLGAKKGGHLPGWQSVPVHDPVVQDAANHAIKTIQQRSNSL 308 FKELQEF+H GDS S+T +DLGAK+GGH PGW++VP HDPVVQ+AANHA+KTIQQRSNSL Sbjct: 121 FKELQEFRHLGDSSSVTAADLGAKQGGHQPGWRTVPAHDPVVQEAANHAVKTIQQRSNSL 180 Query: 307 LPYELREIIHAKAEVIEESAKFDMLL 230 PYEL EI+ A+AEVIE+SAKFD+LL Sbjct: 181 APYELLEILLAQAEVIEDSAKFDLLL 206 >XP_010520100.1 PREDICTED: cysteine proteinase inhibitor 6 [Tarenaya hassleriana] Length = 201 Score = 140 bits (353), Expect = 4e-39 Identities = 67/86 (77%), Positives = 74/86 (86%) Frame = -3 Query: 487 FKELQEFKHAGDSPSITPSDLGAKKGGHLPGWQSVPVHDPVVQDAANHAIKTIQQRSNSL 308 FKELQEFKHAGDSPSIT SDLG KK GH GW++VPVHDP VQ A+HAIKTIQQRSNSL Sbjct: 83 FKELQEFKHAGDSPSITSSDLGVKKDGHESGWRAVPVHDPEVQHVADHAIKTIQQRSNSL 142 Query: 307 LPYELREIIHAKAEVIEESAKFDMLL 230 PYEL+E++HA AEV E +AKFDMLL Sbjct: 143 FPYELQEVVHANAEVTEGAAKFDMLL 168 >XP_010244435.1 PREDICTED: cysteine proteinase inhibitor 12-like [Nelumbo nucifera] Length = 239 Score = 141 bits (356), Expect = 4e-39 Identities = 65/86 (75%), Positives = 76/86 (88%) Frame = -3 Query: 487 FKELQEFKHAGDSPSITPSDLGAKKGGHLPGWQSVPVHDPVVQDAANHAIKTIQQRSNSL 308 FKELQEFK GD+P+ T SDLGA++ GH PGW++VP HDP+VQDAANHA+KTIQQRSNSL Sbjct: 121 FKELQEFKPVGDAPTFTSSDLGARRDGHGPGWRAVPAHDPIVQDAANHAVKTIQQRSNSL 180 Query: 307 LPYELREIIHAKAEVIEESAKFDMLL 230 PYEL E++HAKAEVIEE AKFD+LL Sbjct: 181 APYELLEVLHAKAEVIEEVAKFDLLL 206 >XP_006471323.1 PREDICTED: cysteine proteinase inhibitor 12 [Citrus sinensis] Length = 235 Score = 140 bits (353), Expect = 1e-38 Identities = 69/87 (79%), Positives = 75/87 (86%), Gaps = 1/87 (1%) Frame = -3 Query: 487 FKELQEFKHAGDSP-SITPSDLGAKKGGHLPGWQSVPVHDPVVQDAANHAIKTIQQRSNS 311 FK+LQEFKH GDSP S T SDLG KK GH PGWQ+VPVHDP VQDAANHAI+TIQQRSNS Sbjct: 117 FKDLQEFKHVGDSPASFTSSDLGVKKDGHCPGWQAVPVHDPQVQDAANHAIQTIQQRSNS 176 Query: 310 LLPYELREIIHAKAEVIEESAKFDMLL 230 L PY L+EI+HAKAEVIE+ AKF MLL Sbjct: 177 LFPYVLQEIVHAKAEVIEDFAKFAMLL 203 >XP_006432368.1 hypothetical protein CICLE_v10002346mg [Citrus clementina] ESR45608.1 hypothetical protein CICLE_v10002346mg [Citrus clementina] Length = 235 Score = 140 bits (353), Expect = 1e-38 Identities = 69/87 (79%), Positives = 75/87 (86%), Gaps = 1/87 (1%) Frame = -3 Query: 487 FKELQEFKHAGDSP-SITPSDLGAKKGGHLPGWQSVPVHDPVVQDAANHAIKTIQQRSNS 311 FK+LQEFKH GDSP S T SDLG KK GH PGWQ+VPVHDP VQDAANHAI+TIQQRSNS Sbjct: 117 FKDLQEFKHVGDSPASFTSSDLGVKKDGHCPGWQAVPVHDPQVQDAANHAIQTIQQRSNS 176 Query: 310 LLPYELREIIHAKAEVIEESAKFDMLL 230 L PY L+EI+HAKAEVIE+ AKF MLL Sbjct: 177 LFPYVLQEIVHAKAEVIEDFAKFAMLL 203