BLASTX nr result
ID: Panax24_contig00001096
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00001096 (509 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010095692.1 BTB/POZ domain-containing protein [Morus notabili... 57 2e-06 KOM35730.1 hypothetical protein LR48_Vigan02g188000 [Vigna angul... 55 6e-06 XP_017413142.1 PREDICTED: BTB/POZ domain-containing protein At5g... 55 7e-06 XP_014511902.1 PREDICTED: BTB/POZ domain-containing protein At5g... 55 7e-06 >XP_010095692.1 BTB/POZ domain-containing protein [Morus notabilis] EXB61831.1 BTB/POZ domain-containing protein [Morus notabilis] Length = 688 Score = 57.0 bits (136), Expect = 2e-06 Identities = 28/50 (56%), Positives = 38/50 (76%), Gaps = 3/50 (6%) Frame = -3 Query: 393 VKMELNATNVVGVRCAAKYLQMNEDFGEGN---QRDFLLRQIRGHITSKV 253 VK+ELNA+N+V VRCAA+YLQM+ED+GEGN Q + L +I G+ T + Sbjct: 146 VKIELNASNIVSVRCAAEYLQMSEDYGEGNLIIQTETFLNEIFGNWTDSL 195 >KOM35730.1 hypothetical protein LR48_Vigan02g188000 [Vigna angularis] Length = 561 Score = 55.5 bits (132), Expect = 6e-06 Identities = 28/59 (47%), Positives = 41/59 (69%), Gaps = 3/59 (5%) Frame = -3 Query: 417 HSSWILFLVKMELNATNVVGVRCAAKYLQMNEDFGEGN---QRDFLLRQIRGHITSKVM 250 H + + VKMEL A+NVVG+RCAA+YLQM+E++GEGN Q + L + G+ T ++ Sbjct: 27 HVAKFCYGVKMELTASNVVGLRCAAEYLQMSENYGEGNLIMQTEKFLNHVFGYWTDTLV 85 >XP_017413142.1 PREDICTED: BTB/POZ domain-containing protein At5g03250-like [Vigna angularis] BAT94478.1 hypothetical protein VIGAN_08108500 [Vigna angularis var. angularis] Length = 617 Score = 55.5 bits (132), Expect = 7e-06 Identities = 28/59 (47%), Positives = 41/59 (69%), Gaps = 3/59 (5%) Frame = -3 Query: 417 HSSWILFLVKMELNATNVVGVRCAAKYLQMNEDFGEGN---QRDFLLRQIRGHITSKVM 250 H + + VKMEL A+NVVG+RCAA+YLQM+E++GEGN Q + L + G+ T ++ Sbjct: 83 HVAKFCYGVKMELTASNVVGLRCAAEYLQMSENYGEGNLIMQTEKFLNHVFGYWTDTLV 141 >XP_014511902.1 PREDICTED: BTB/POZ domain-containing protein At5g03250 [Vigna radiata var. radiata] Length = 617 Score = 55.5 bits (132), Expect = 7e-06 Identities = 28/59 (47%), Positives = 41/59 (69%), Gaps = 3/59 (5%) Frame = -3 Query: 417 HSSWILFLVKMELNATNVVGVRCAAKYLQMNEDFGEGN---QRDFLLRQIRGHITSKVM 250 H + + VKMEL A+NVVG+RCAA+YLQM+E++GEGN Q + L + G+ T ++ Sbjct: 83 HVAKFCYGVKMELTASNVVGLRCAAEYLQMSENYGEGNLIMQTEKFLNHVFGYWTDTLV 141