BLASTX nr result
ID: Panax24_contig00000951
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00000951 (357 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CDP17135.1 unnamed protein product [Coffea canephora] 60 7e-10 KZN03639.1 hypothetical protein DCAR_012395 [Daucus carota subsp... 56 1e-06 >CDP17135.1 unnamed protein product [Coffea canephora] Length = 70 Score = 60.5 bits (145), Expect = 7e-10 Identities = 29/38 (76%), Positives = 30/38 (78%) Frame = +1 Query: 10 MWILKWVVCGTFADLLQDPDLRCHLARNVLVKAQKSAS 123 MWIL WVV GTFADL QDPD HLARNVL KAQK A+ Sbjct: 1 MWILNWVVSGTFADLHQDPDPPHHLARNVLTKAQKGAA 38 >KZN03639.1 hypothetical protein DCAR_012395 [Daucus carota subsp. sativus] Length = 995 Score = 55.8 bits (133), Expect = 1e-06 Identities = 28/40 (70%), Positives = 29/40 (72%) Frame = +1 Query: 1 KRNMWILKWVVCGTFADLLQDPDLRCHLARNVLVKAQKSA 120 KRN WIL WVV GTFAD Q P L+ HL RNVLVKA K A Sbjct: 935 KRNNWILNWVVFGTFADHGQGPGLQHHLGRNVLVKAPKRA 974