BLASTX nr result
ID: Panax24_contig00000899
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00000899 (530 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM90625.1 hypothetical protein DCAR_022010 [Daucus carota subsp... 77 3e-13 XP_017256136.1 PREDICTED: probable E3 ubiquitin ligase SUD1 isof... 77 3e-13 XP_017256135.1 PREDICTED: probable E3 ubiquitin ligase SUD1 isof... 77 3e-13 EEF43655.1 ssm4 protein, putative [Ricinus communis] 54 9e-06 >KZM90625.1 hypothetical protein DCAR_022010 [Daucus carota subsp. sativus] Length = 1100 Score = 77.0 bits (188), Expect = 3e-13 Identities = 33/50 (66%), Positives = 44/50 (88%) Frame = -2 Query: 529 NFGEDKEARQNETEIDSEMQDANVQDNGLILQDGEEADVGLRQRRAIRQD 380 NFGEDKE R+N+ ++ SE+QDAN+QD ++L +G+EADVG+RQRRAIRQD Sbjct: 1050 NFGEDKEVRRNDPDVSSEIQDANIQDPTMVLHEGDEADVGMRQRRAIRQD 1099 >XP_017256136.1 PREDICTED: probable E3 ubiquitin ligase SUD1 isoform X2 [Daucus carota subsp. sativus] Length = 1115 Score = 77.0 bits (188), Expect = 3e-13 Identities = 33/50 (66%), Positives = 44/50 (88%) Frame = -2 Query: 529 NFGEDKEARQNETEIDSEMQDANVQDNGLILQDGEEADVGLRQRRAIRQD 380 NFGEDKE R+N+ ++ SE+QDAN+QD ++L +G+EADVG+RQRRAIRQD Sbjct: 1065 NFGEDKEVRRNDPDVSSEIQDANIQDPTMVLHEGDEADVGMRQRRAIRQD 1114 >XP_017256135.1 PREDICTED: probable E3 ubiquitin ligase SUD1 isoform X1 [Daucus carota subsp. sativus] Length = 1116 Score = 77.0 bits (188), Expect = 3e-13 Identities = 33/50 (66%), Positives = 44/50 (88%) Frame = -2 Query: 529 NFGEDKEARQNETEIDSEMQDANVQDNGLILQDGEEADVGLRQRRAIRQD 380 NFGEDKE R+N+ ++ SE+QDAN+QD ++L +G+EADVG+RQRRAIRQD Sbjct: 1066 NFGEDKEVRRNDPDVSSEIQDANIQDPTMVLHEGDEADVGMRQRRAIRQD 1115 >EEF43655.1 ssm4 protein, putative [Ricinus communis] Length = 214 Score = 54.3 bits (129), Expect = 9e-06 Identities = 28/51 (54%), Positives = 36/51 (70%) Frame = -2 Query: 529 NFGEDKEARQNETEIDSEMQDANVQDNGLILQDGEEADVGLRQRRAIRQDA 377 NFGEDKE R+NE SE+Q++N+Q LI DG E +VGLR RR +Q+A Sbjct: 164 NFGEDKEERENEAGTSSEVQNSNLQGADLIRNDG-EVEVGLRLRRVYQQEA 213