BLASTX nr result
ID: Panax24_contig00000390
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00000390 (404 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017231570.1 PREDICTED: protein STAY-GREEN, chloroplastic-like... 58 2e-07 AKA88530.1 stay green protein [Litchi chinensis] 55 3e-06 XP_017232560.1 PREDICTED: protein STAY-GREEN, chloroplastic-like... 54 9e-06 >XP_017231570.1 PREDICTED: protein STAY-GREEN, chloroplastic-like [Daucus carota subsp. sativus] KZN08347.1 hypothetical protein DCAR_000893 [Daucus carota subsp. sativus] Length = 272 Score = 58.2 bits (139), Expect = 2e-07 Identities = 24/40 (60%), Positives = 30/40 (75%), Gaps = 3/40 (7%) Frame = -1 Query: 404 PCKEECSCCFPPMSSIPWPPHLPNTI---TDDTHESLPQQ 294 PC+E CSCCFPPMSSIPWP L N + +D+ +SLPQ+ Sbjct: 232 PCEEACSCCFPPMSSIPWPRQLSNPVEQSSDEAIQSLPQE 271 >AKA88530.1 stay green protein [Litchi chinensis] Length = 268 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/37 (62%), Positives = 27/37 (72%), Gaps = 1/37 (2%) Frame = -1 Query: 401 CKEECSCCFPPMSSIPWPPHLP-NTITDDTHESLPQQ 294 C+E+C+CCFPPMS IPWP LP N TH+SL QQ Sbjct: 231 CQEDCTCCFPPMSLIPWPQMLPHNNENHGTHQSLQQQ 267 >XP_017232560.1 PREDICTED: protein STAY-GREEN, chloroplastic-like [Daucus carota subsp. sativus] KZN07595.1 hypothetical protein DCAR_008432 [Daucus carota subsp. sativus] Length = 274 Score = 53.5 bits (127), Expect = 9e-06 Identities = 21/38 (55%), Positives = 26/38 (68%) Frame = -1 Query: 404 PCKEECSCCFPPMSSIPWPPHLPNTITDDTHESLPQQQ 291 PC E+C CCFP MSSIPW H +D+T +SLP+ Q Sbjct: 237 PCIEDCDCCFPTMSSIPWLQHTFTQTSDETTQSLPEHQ 274