BLASTX nr result
ID: Panax21_contig00039426
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00039426 (669 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002330941.1| predicted protein [Populus trichocarpa] gi|2... 69 8e-10 ref|XP_002511547.1| protein binding protein, putative [Ricinus c... 66 7e-09 emb|CBY19047.1| unnamed protein product [Oikopleura dioica] 65 9e-09 ref|XP_002310515.1| predicted protein [Populus trichocarpa] gi|2... 65 9e-09 ref|XP_002327933.1| predicted protein [Populus trichocarpa] gi|2... 65 1e-08 >ref|XP_002330941.1| predicted protein [Populus trichocarpa] gi|222873135|gb|EEF10266.1| predicted protein [Populus trichocarpa] Length = 211 Score = 68.9 bits (167), Expect = 8e-10 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +1 Query: 391 CCPICLNELSVGNEACRTPCLHLYHSQCLSRWLETGASCPICR 519 CCPICL + SVG+EA T C H+YHS C+ +WL ASCP+CR Sbjct: 163 CCPICLQDFSVGSEAAATTCSHVYHSHCIVKWLLRSASCPMCR 205 >ref|XP_002511547.1| protein binding protein, putative [Ricinus communis] gi|223550662|gb|EEF52149.1| protein binding protein, putative [Ricinus communis] Length = 219 Score = 65.9 bits (159), Expect = 7e-09 Identities = 25/46 (54%), Positives = 31/46 (67%) Frame = +1 Query: 394 CPICLNELSVGNEACRTPCLHLYHSQCLSRWLETGASCPICRFPAA 531 C ICL EL +G+E R PCLH+YH QC+ WL+ CP+CRF A Sbjct: 174 CIICLEELLIGSEVTRLPCLHVYHKQCIINWLQKSRFCPLCRFEIA 219 >emb|CBY19047.1| unnamed protein product [Oikopleura dioica] Length = 359 Score = 65.5 bits (158), Expect = 9e-09 Identities = 23/45 (51%), Positives = 30/45 (66%) Frame = +1 Query: 388 DCCPICLNELSVGNEACRTPCLHLYHSQCLSRWLETGASCPICRF 522 D CP+CL EL+ NE R PCLH+ H +C+ WL+ CPIC+F Sbjct: 309 DTCPVCLEELATNNEVRRLPCLHVLHKECIDPWLKNNKECPICKF 353 >ref|XP_002310515.1| predicted protein [Populus trichocarpa] gi|222853418|gb|EEE90965.1| predicted protein [Populus trichocarpa] Length = 231 Score = 65.5 bits (158), Expect = 9e-09 Identities = 22/43 (51%), Positives = 31/43 (72%) Frame = +1 Query: 394 CPICLNELSVGNEACRTPCLHLYHSQCLSRWLETGASCPICRF 522 C +C+ E+ G+EA R PC H+YHS C+ RWL+T CP+CR+ Sbjct: 182 CTVCMEEIDAGSEAIRMPCSHVYHSDCIVRWLQTSHMCPLCRY 224 >ref|XP_002327933.1| predicted protein [Populus trichocarpa] gi|222837342|gb|EEE75721.1| predicted protein [Populus trichocarpa] Length = 145 Score = 65.1 bits (157), Expect = 1e-08 Identities = 24/42 (57%), Positives = 30/42 (71%) Frame = +1 Query: 394 CPICLNELSVGNEACRTPCLHLYHSQCLSRWLETGASCPICR 519 CP+CL L +G+EA T C HLYHS C+ +WL T SCP+CR Sbjct: 94 CPVCLEHLLIGSEAACTTCSHLYHSHCIVKWLVTSTSCPLCR 135