BLASTX nr result
ID: Panax21_contig00039355
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00039355 (532 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI35712.3| unnamed protein product [Vitis vinifera] 63 2e-08 >emb|CBI35712.3| unnamed protein product [Vitis vinifera] Length = 412 Score = 63.2 bits (152), Expect = 2e-08 Identities = 31/49 (63%), Positives = 38/49 (77%) Frame = +1 Query: 154 VKKAMLGYMSHRATLWSYYCRFYVQRGTNAPISWILFAFSQQPLLYGRL 300 + +AMLGYMSH AT + R+YVQ GTNAPISWILFAF++Q L +G L Sbjct: 59 LSQAMLGYMSHCATHGRGHRRYYVQPGTNAPISWILFAFNRQLLPFGEL 107