BLASTX nr result
ID: Panax21_contig00038445
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00038445 (573 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003633738.1| PREDICTED: pentatricopeptide repeat-containi... 61 1e-07 ref|XP_002531188.1| pentatricopeptide repeat-containing protein,... 57 2e-06 ref|XP_004171986.1| PREDICTED: pentatricopeptide repeat-containi... 57 2e-06 ref|XP_004140361.1| PREDICTED: pentatricopeptide repeat-containi... 57 3e-06 ref|XP_002305195.1| predicted protein [Populus trichocarpa] gi|2... 57 3e-06 >ref|XP_003633738.1| PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial-like [Vitis vinifera] Length = 547 Score = 60.8 bits (146), Expect = 1e-07 Identities = 29/61 (47%), Positives = 42/61 (68%) Frame = +3 Query: 3 KMEEADKYLKIMKDRSLTPCAYLYEMLITGHFARGNKTRGHQLYCEMVGSGLKASSQTHL 182 K+E+A+KYL+IMKDRS+ +YE LI+ +F +G++ R QL+ EMV GLK S + Sbjct: 486 KLEKAEKYLRIMKDRSIAISTCVYETLISSYFEKGDELRASQLHNEMVSRGLKPSCSYMV 545 Query: 183 H 185 H Sbjct: 546 H 546 >ref|XP_002531188.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223529229|gb|EEF31203.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 619 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/51 (50%), Positives = 34/51 (66%) Frame = +3 Query: 3 KMEEADKYLKIMKDRSLTPCAYLYEMLITGHFARGNKTRGHQLYCEMVGSG 155 K+E+A+KYL+IMK RSL P +YE LI GH + + R QLY EM+ G Sbjct: 494 KLEQAEKYLRIMKGRSLNPSQQVYEALIAGHLEKSDTARALQLYNEMISKG 544 >ref|XP_004171986.1| PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial-like [Cucumis sativus] Length = 539 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/51 (49%), Positives = 37/51 (72%) Frame = +3 Query: 3 KMEEADKYLKIMKDRSLTPCAYLYEMLITGHFARGNKTRGHQLYCEMVGSG 155 ++EEA+KYLKI+KD SLTPC +Y+ LI + +GN+ + +LY EM+ G Sbjct: 489 RLEEAEKYLKIVKDSSLTPCLSIYQALILFYLKKGNRAKALELYNEMMFDG 539 >ref|XP_004140361.1| PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial-like [Cucumis sativus] Length = 517 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/51 (49%), Positives = 37/51 (72%) Frame = +3 Query: 3 KMEEADKYLKIMKDRSLTPCAYLYEMLITGHFARGNKTRGHQLYCEMVGSG 155 ++EEA+KYLKI+KD SLTPC +Y+ LI + +GN+ + +LY EM+ G Sbjct: 467 RLEEAEKYLKIVKDSSLTPCLSIYQALILLYLKKGNRAKALELYNEMMFDG 517 >ref|XP_002305195.1| predicted protein [Populus trichocarpa] gi|222848159|gb|EEE85706.1| predicted protein [Populus trichocarpa] Length = 556 Score = 56.6 bits (135), Expect = 3e-06 Identities = 30/60 (50%), Positives = 38/60 (63%) Frame = +3 Query: 3 KMEEADKYLKIMKDRSLTPCAYLYEMLITGHFARGNKTRGHQLYCEMVGSGLKASSQTHL 182 K+EEA+KYL+IM RSL P +YE LI +F +G+K R LY EMV GLK +L Sbjct: 493 KLEEAEKYLRIMIGRSLNPREDVYEALIKVYFEKGDKRRALNLYNEMVSKGLKLCCSHYL 552