BLASTX nr result
ID: Panax21_contig00038275
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00038275 (547 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAG43545.1|AF211527_1 Avr9/Cf-9 rapidly elicited protein 1 [N... 67 2e-09 >gb|AAG43545.1|AF211527_1 Avr9/Cf-9 rapidly elicited protein 1 [Nicotiana tabacum] Length = 237 Score = 67.0 bits (162), Expect = 2e-09 Identities = 34/79 (43%), Positives = 49/79 (62%) Frame = +3 Query: 309 VIDLTSPTPVDSTLRKPSLKIELPPVKKFEWLNYLTESTQQPAAAATSVEKVKKAAIFSS 488 +IDLTSP + + RKPSLKI+LPPVKKFEW+ + +TQ + + ++++ +K Sbjct: 76 IIDLTSPKLSNVSDRKPSLKIDLPPVKKFEWIGFCNSTTQSNSIVSVTMQQKRK------ 129 Query: 489 TVXXXXXXXSEEKRHYRGV 545 +EEKRHYRGV Sbjct: 130 ---------TEEKRHYRGV 139