BLASTX nr result
ID: Panax21_contig00037601
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00037601 (451 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002277923.1| PREDICTED: pentatricopeptide repeat-containi... 62 4e-08 emb|CBI30210.3| unnamed protein product [Vitis vinifera] 62 4e-08 ref|XP_004156326.1| PREDICTED: pentatricopeptide repeat-containi... 59 4e-07 ref|XP_004143370.1| PREDICTED: pentatricopeptide repeat-containi... 59 4e-07 ref|XP_002323489.1| predicted protein [Populus trichocarpa] gi|2... 56 3e-06 >ref|XP_002277923.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800-like [Vitis vinifera] Length = 882 Score = 62.4 bits (150), Expect = 4e-08 Identities = 36/82 (43%), Positives = 51/82 (62%), Gaps = 5/82 (6%) Frame = +3 Query: 213 SVQSQPISTLFPQNPTNNSSSFNEEFP-----TISEYGNLLHIAVRYKDIELARAVHASV 377 S +S+P + L P +N + FP T++++ LL ++VRY D+EL +AVHAS+ Sbjct: 39 SSRSKPYALLTSHPPLSNQPALLSNFPSVSNDTVNDHYYLLDLSVRYDDVELIKAVHASI 98 Query: 378 LKLEQEDILLWNTLLAAYLKLG 443 KL EDI L N L+ AYLKLG Sbjct: 99 FKL-AEDIHLANALIVAYLKLG 119 >emb|CBI30210.3| unnamed protein product [Vitis vinifera] Length = 900 Score = 62.4 bits (150), Expect = 4e-08 Identities = 36/82 (43%), Positives = 51/82 (62%), Gaps = 5/82 (6%) Frame = +3 Query: 213 SVQSQPISTLFPQNPTNNSSSFNEEFP-----TISEYGNLLHIAVRYKDIELARAVHASV 377 S +S+P + L P +N + FP T++++ LL ++VRY D+EL +AVHAS+ Sbjct: 57 SSRSKPYALLTSHPPLSNQPALLSNFPSVSNDTVNDHYYLLDLSVRYDDVELIKAVHASI 116 Query: 378 LKLEQEDILLWNTLLAAYLKLG 443 KL EDI L N L+ AYLKLG Sbjct: 117 FKL-AEDIHLANALIVAYLKLG 137 >ref|XP_004156326.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800-like [Cucumis sativus] Length = 908 Score = 58.9 bits (141), Expect = 4e-07 Identities = 34/63 (53%), Positives = 41/63 (65%) Frame = +3 Query: 255 PTNNSSSFNEEFPTISEYGNLLHIAVRYKDIELARAVHASVLKLEQEDILLWNTLLAAYL 434 P S S N TI+ +LL ++ RY D +LARAVHA LKLE EDI L N L++AYL Sbjct: 83 PLFASRSLNTSLSTIASPFDLLRLSTRYGDPDLARAVHAQFLKLE-EDIFLGNALISAYL 141 Query: 435 KLG 443 KLG Sbjct: 142 KLG 144 >ref|XP_004143370.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800-like [Cucumis sativus] Length = 908 Score = 58.9 bits (141), Expect = 4e-07 Identities = 34/63 (53%), Positives = 41/63 (65%) Frame = +3 Query: 255 PTNNSSSFNEEFPTISEYGNLLHIAVRYKDIELARAVHASVLKLEQEDILLWNTLLAAYL 434 P S S N TI+ +LL ++ RY D +LARAVHA LKLE EDI L N L++AYL Sbjct: 83 PLFASRSLNTSLSTIASPFDLLRLSTRYGDPDLARAVHAQFLKLE-EDIFLGNALISAYL 141 Query: 435 KLG 443 KLG Sbjct: 142 KLG 144 >ref|XP_002323489.1| predicted protein [Populus trichocarpa] gi|222868119|gb|EEF05250.1| predicted protein [Populus trichocarpa] Length = 915 Score = 56.2 bits (134), Expect = 3e-06 Identities = 32/74 (43%), Positives = 48/74 (64%), Gaps = 1/74 (1%) Frame = +3 Query: 225 QPISTLFPQNPTNNSSSFNEE-FPTISEYGNLLHIAVRYKDIELARAVHASVLKLEQEDI 401 Q + + FP + +S N + + + NLL ++V+Y DI+LARA+HAS+LKL ED Sbjct: 79 QNLESSFPLDSNYHSPQTNTDCLIEVDDLFNLLRLSVKYTDIDLARALHASILKL-GEDT 137 Query: 402 LLWNTLLAAYLKLG 443 L N ++AAY+KLG Sbjct: 138 HLGNAVIAAYIKLG 151