BLASTX nr result
ID: Panax21_contig00037313
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00037313 (408 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003516879.1| PREDICTED: tRNA-dihydrouridine synthase 2-li... 103 1e-20 ref|XP_003516878.1| PREDICTED: tRNA-dihydrouridine synthase 2-li... 103 1e-20 ref|XP_003628830.1| tRNA-dihydrouridine synthase 2-like protein ... 103 1e-20 ref|XP_003531966.1| PREDICTED: tRNA-dihydrouridine synthase 2-li... 102 2e-20 ref|XP_002528905.1| tRNA-dihydrouridine synthase, putative [Rici... 102 2e-20 >ref|XP_003516879.1| PREDICTED: tRNA-dihydrouridine synthase 2-like isoform 2 [Glycine max] Length = 321 Score = 103 bits (257), Expect = 1e-20 Identities = 45/57 (78%), Positives = 56/57 (98%) Frame = -2 Query: 173 MDYRNKLVLAPMVRVGTLPFRLLSAEYGADITYGEEIIDHKLIKCERRVNDVLGSVD 3 M+YRNKLVLAPMVRVGTLPFRLL+A+YGADITYGEEIIDHK++KC+R++N+++GS D Sbjct: 1 MEYRNKLVLAPMVRVGTLPFRLLAAQYGADITYGEEIIDHKMLKCDRQINELIGSTD 57 >ref|XP_003516878.1| PREDICTED: tRNA-dihydrouridine synthase 2-like isoform 1 [Glycine max] Length = 320 Score = 103 bits (257), Expect = 1e-20 Identities = 45/57 (78%), Positives = 56/57 (98%) Frame = -2 Query: 173 MDYRNKLVLAPMVRVGTLPFRLLSAEYGADITYGEEIIDHKLIKCERRVNDVLGSVD 3 M+YRNKLVLAPMVRVGTLPFRLL+A+YGADITYGEEIIDHK++KC+R++N+++GS D Sbjct: 1 MEYRNKLVLAPMVRVGTLPFRLLAAQYGADITYGEEIIDHKMLKCDRQINELIGSTD 57 >ref|XP_003628830.1| tRNA-dihydrouridine synthase 2-like protein [Medicago truncatula] gi|355522852|gb|AET03306.1| tRNA-dihydrouridine synthase 2-like protein [Medicago truncatula] Length = 322 Score = 103 bits (257), Expect = 1e-20 Identities = 47/57 (82%), Positives = 53/57 (92%) Frame = -2 Query: 173 MDYRNKLVLAPMVRVGTLPFRLLSAEYGADITYGEEIIDHKLIKCERRVNDVLGSVD 3 MDYRNK +LAPMVRVGTLP RLL+AEYGADITYGEEI+DHK+IKCERR+N+ LGS D Sbjct: 1 MDYRNKKILAPMVRVGTLPLRLLAAEYGADITYGEEIVDHKIIKCERRINEHLGSTD 57 >ref|XP_003531966.1| PREDICTED: tRNA-dihydrouridine synthase 2-like [Glycine max] Length = 320 Score = 102 bits (255), Expect = 2e-20 Identities = 46/57 (80%), Positives = 55/57 (96%) Frame = -2 Query: 173 MDYRNKLVLAPMVRVGTLPFRLLSAEYGADITYGEEIIDHKLIKCERRVNDVLGSVD 3 M+YRNKLVLAPMVRVGTLPFRLL+A+YGADITY EEIIDHK++KCERR+N+++GS D Sbjct: 1 MEYRNKLVLAPMVRVGTLPFRLLAAQYGADITYCEEIIDHKMLKCERRINELIGSTD 57 >ref|XP_002528905.1| tRNA-dihydrouridine synthase, putative [Ricinus communis] gi|223531659|gb|EEF33485.1| tRNA-dihydrouridine synthase, putative [Ricinus communis] Length = 330 Score = 102 bits (255), Expect = 2e-20 Identities = 47/57 (82%), Positives = 53/57 (92%) Frame = -2 Query: 173 MDYRNKLVLAPMVRVGTLPFRLLSAEYGADITYGEEIIDHKLIKCERRVNDVLGSVD 3 M+Y NKLVLAPMVRVGTLPFRLL+AEYGADITYGEEIIDHKL+KCER+VN+ +G D Sbjct: 1 MEYENKLVLAPMVRVGTLPFRLLAAEYGADITYGEEIIDHKLLKCERKVNEYIGCTD 57