BLASTX nr result
ID: Panax21_contig00037128
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00037128 (430 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN75306.1| hypothetical protein VITISV_040403 [Vitis vinifera] 134 6e-30 ref|NP_186807.2| pentatricopeptide repeat-containing protein [Ar... 66 3e-09 gb|AAF01561.1|AC009325_31 hypothetical protein [Arabidopsis thal... 66 3e-09 ref|XP_002510452.1| pentatricopeptide repeat-containing protein,... 65 7e-09 ref|XP_002299231.1| predicted protein [Populus trichocarpa] gi|2... 64 2e-08 >emb|CAN75306.1| hypothetical protein VITISV_040403 [Vitis vinifera] Length = 826 Score = 134 bits (338), Expect = 6e-30 Identities = 72/131 (54%), Positives = 98/131 (74%), Gaps = 3/131 (2%) Frame = -1 Query: 385 FHHACHLFVEITKRRYSFIRNSAYGLNYSTLWENHSYYHDQSEVLGENEDVISWTSKISS 206 F +A +F EIT+R FIRNSAY L Y +++ ++YY + E GE ++VISWTSKISS Sbjct: 5 FRNAYKVFEEITQRNV-FIRNSAYSLYYRSMFNTYAYYEEPVEFHGEKDNVISWTSKISS 63 Query: 205 LVRRNKPQEAIGLFRTMLMSEQKPNYVTVLSLIRALNS---ENMTREIHGFVITLGFESE 35 LV++N+ + A+GLF+ MLM+EQ+PN+VTVLS+IRA++ E+M R I G VI LGFESE Sbjct: 64 LVKQNQSELAVGLFKMMLMTEQRPNHVTVLSVIRAISGLGLEDMMRVICGSVIKLGFESE 123 Query: 34 MSVITALLNVY 2 +SV TAL+ Y Sbjct: 124 VSVATALIGFY 134 >ref|NP_186807.2| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|218546765|sp|Q9SS97.2|PP205_ARATH RecName: Full=Putative pentatricopeptide repeat-containing protein At3g01580 gi|332640170|gb|AEE73691.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 660 Score = 66.2 bits (160), Expect = 3e-09 Identities = 31/86 (36%), Positives = 56/86 (65%), Gaps = 4/86 (4%) Frame = -1 Query: 247 ENEDVISWTSKISSLVRRNKPQEAIGLFRTMLM-SEQKPNYVTVLSLIRA---LNSENMT 80 E D+++W+S +S + P +A+ FR M+M S+ P+ VT+++L+ A L++ + Sbjct: 123 EKPDIVTWSSMVSGFEKNGSPYQAVEFFRRMVMASDVTPDRVTLITLVSACTKLSNSRLG 182 Query: 79 REIHGFVITLGFESEMSVITALLNVY 2 R +HGFVI GF +++S++ +LLN Y Sbjct: 183 RCVHGFVIRRGFSNDLSLVNSLLNCY 208 >gb|AAF01561.1|AC009325_31 hypothetical protein [Arabidopsis thaliana] Length = 641 Score = 66.2 bits (160), Expect = 3e-09 Identities = 31/86 (36%), Positives = 56/86 (65%), Gaps = 4/86 (4%) Frame = -1 Query: 247 ENEDVISWTSKISSLVRRNKPQEAIGLFRTMLM-SEQKPNYVTVLSLIRA---LNSENMT 80 E D+++W+S +S + P +A+ FR M+M S+ P+ VT+++L+ A L++ + Sbjct: 104 EKPDIVTWSSMVSGFEKNGSPYQAVEFFRRMVMASDVTPDRVTLITLVSACTKLSNSRLG 163 Query: 79 REIHGFVITLGFESEMSVITALLNVY 2 R +HGFVI GF +++S++ +LLN Y Sbjct: 164 RCVHGFVIRRGFSNDLSLVNSLLNCY 189 >ref|XP_002510452.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223551153|gb|EEF52639.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 1218 Score = 64.7 bits (156), Expect = 7e-09 Identities = 34/89 (38%), Positives = 54/89 (60%), Gaps = 3/89 (3%) Frame = -1 Query: 259 EVLGENEDVISWTSKISSLVRRNKPQEAIGLFRTMLMSEQKPNYVTVLSLIRA---LNSE 89 EVLG + DV++WTS IS L + +K +A+ LF M+++ +PN VT+ S + A L Sbjct: 302 EVLGTSPDVVTWTSMISGLAQNDKASKALHLFNDMILARVEPNGVTISSAVSACASLKVL 361 Query: 88 NMTREIHGFVITLGFESEMSVITALLNVY 2 N EIH + LGF ++ V +L+++Y Sbjct: 362 NEGLEIHALAVKLGFVEDVLVGNSLIDMY 390 >ref|XP_002299231.1| predicted protein [Populus trichocarpa] gi|222846489|gb|EEE84036.1| predicted protein [Populus trichocarpa] Length = 668 Score = 63.5 bits (153), Expect = 2e-08 Identities = 29/82 (35%), Positives = 54/82 (65%), Gaps = 3/82 (3%) Frame = -1 Query: 238 DVISWTSKISSLVRRNKPQEAIGLFRTMLMSEQKPNYVTVLSLIRA---LNSENMTREIH 68 D++SW S I+ VRR +P+EA+G+++ M+ KP+ VT++ ++ A L S + REIH Sbjct: 219 DLVSWNSLINGYVRRRQPREAMGIYQQMITEHVKPDEVTMIGVVSACAQLESLKLGREIH 278 Query: 67 GFVITLGFESEMSVITALLNVY 2 ++ G ++S++ AL+++Y Sbjct: 279 RYIEESGLNLKISLVNALMDMY 300