BLASTX nr result
ID: Panax21_contig00037042
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00037042 (399 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN62774.1| hypothetical protein VITISV_019970 [Vitis vinifera] 55 6e-06 >emb|CAN62774.1| hypothetical protein VITISV_019970 [Vitis vinifera] Length = 524 Score = 55.1 bits (131), Expect = 6e-06 Identities = 30/66 (45%), Positives = 41/66 (62%), Gaps = 5/66 (7%) Frame = +1 Query: 43 DGNHG--GQTSADPIQVPVGPITRS*AKRFKEGLNGLIQEVWTKN---EPKTSAMEVDSK 207 +GN G + +A PIQV VGP+TR+ AK+FKE LNGLIQ +W K PK V Sbjct: 456 EGNEGMTNKWNATPIQVLVGPVTRARAKKFKETLNGLIQNIWAKMNSWRPKKDVSRVPQG 515 Query: 208 FINLVR 225 I++++ Sbjct: 516 SISMIQ 521