BLASTX nr result
ID: Panax21_contig00036966
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00036966 (419 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI19832.3| unnamed protein product [Vitis vinifera] 176 2e-42 ref|XP_002280360.1| PREDICTED: pentatricopeptide repeat-containi... 176 2e-42 ref|XP_003590744.1| Pentatricopeptide repeat-containing protein ... 169 3e-40 ref|XP_004152758.1| PREDICTED: pentatricopeptide repeat-containi... 167 8e-40 ref|XP_003535453.1| PREDICTED: pentatricopeptide repeat-containi... 166 2e-39 >emb|CBI19832.3| unnamed protein product [Vitis vinifera] Length = 544 Score = 176 bits (446), Expect = 2e-42 Identities = 82/88 (93%), Positives = 85/88 (96%) Frame = -2 Query: 418 TKFVLHDMESEQKEHVLSTHSEKLAVVFGLLKLPLGATIRVFKNLRICGDCHNAFKFMSK 239 TKFVLHDMESEQKE+VLSTHSEKLAV FGLLKLPLGAT+RVFKNLRICGDCHNAFKFMSK Sbjct: 457 TKFVLHDMESEQKEYVLSTHSEKLAVGFGLLKLPLGATVRVFKNLRICGDCHNAFKFMSK 516 Query: 238 AVGREIVVRDGKRFHHFKDGECSCGNYW 155 V REIVVRDGKRFHHFK+GECSCGNYW Sbjct: 517 VVEREIVVRDGKRFHHFKNGECSCGNYW 544 >ref|XP_002280360.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 [Vitis vinifera] Length = 799 Score = 176 bits (446), Expect = 2e-42 Identities = 82/88 (93%), Positives = 85/88 (96%) Frame = -2 Query: 418 TKFVLHDMESEQKEHVLSTHSEKLAVVFGLLKLPLGATIRVFKNLRICGDCHNAFKFMSK 239 TKFVLHDMESEQKE+VLSTHSEKLAV FGLLKLPLGAT+RVFKNLRICGDCHNAFKFMSK Sbjct: 712 TKFVLHDMESEQKEYVLSTHSEKLAVGFGLLKLPLGATVRVFKNLRICGDCHNAFKFMSK 771 Query: 238 AVGREIVVRDGKRFHHFKDGECSCGNYW 155 V REIVVRDGKRFHHFK+GECSCGNYW Sbjct: 772 VVEREIVVRDGKRFHHFKNGECSCGNYW 799 >ref|XP_003590744.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355479792|gb|AES60995.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 795 Score = 169 bits (427), Expect = 3e-40 Identities = 77/88 (87%), Positives = 83/88 (94%) Frame = -2 Query: 418 TKFVLHDMESEQKEHVLSTHSEKLAVVFGLLKLPLGATIRVFKNLRICGDCHNAFKFMSK 239 TKFVLHDMESE KEH LSTHSEKLAVV+G++KLPLGATIRVFKNLRICGDCHNAFK++SK Sbjct: 708 TKFVLHDMESEHKEHSLSTHSEKLAVVYGIMKLPLGATIRVFKNLRICGDCHNAFKYISK 767 Query: 238 AVGREIVVRDGKRFHHFKDGECSCGNYW 155 V REIVVRD KRFHHFK+GECSCGNYW Sbjct: 768 VVEREIVVRDRKRFHHFKNGECSCGNYW 795 >ref|XP_004152758.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like [Cucumis sativus] gi|449504088|ref|XP_004162249.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like [Cucumis sativus] Length = 797 Score = 167 bits (423), Expect = 8e-40 Identities = 76/88 (86%), Positives = 81/88 (92%) Frame = -2 Query: 418 TKFVLHDMESEQKEHVLSTHSEKLAVVFGLLKLPLGATIRVFKNLRICGDCHNAFKFMSK 239 TK+VLHDMESE KE+ LSTHSEKLAV FGL+KLP GAT+RVFKNLRICGDCHNA KFMSK Sbjct: 710 TKYVLHDMESEHKEYALSTHSEKLAVAFGLMKLPQGATVRVFKNLRICGDCHNAIKFMSK 769 Query: 238 AVGREIVVRDGKRFHHFKDGECSCGNYW 155 VGREIVVRDGKRFHHFK+GECSC NYW Sbjct: 770 VVGREIVVRDGKRFHHFKNGECSCRNYW 797 >ref|XP_003535453.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like [Glycine max] Length = 782 Score = 166 bits (419), Expect = 2e-39 Identities = 74/88 (84%), Positives = 83/88 (94%) Frame = -2 Query: 418 TKFVLHDMESEQKEHVLSTHSEKLAVVFGLLKLPLGATIRVFKNLRICGDCHNAFKFMSK 239 TKFVLHDMESEQKE+ LSTHSEKLAVV+G++KLPLGATIRVFKNLRICGDCHNAFK++SK Sbjct: 695 TKFVLHDMESEQKEYALSTHSEKLAVVYGIMKLPLGATIRVFKNLRICGDCHNAFKYISK 754 Query: 238 AVGREIVVRDGKRFHHFKDGECSCGNYW 155 V REI+VRD KRFHHF++GECSC NYW Sbjct: 755 VVDREIIVRDRKRFHHFRNGECSCSNYW 782