BLASTX nr result
ID: Panax21_contig00036393
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00036393 (417 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004135307.1| PREDICTED: OTU domain-containing protein At3... 118 4e-25 ref|XP_002514949.1| OTU domain-containing protein 6B, putative [... 116 2e-24 ref|XP_003537539.1| PREDICTED: OTU domain-containing protein At3... 114 1e-23 tpg|DAA47952.1| TPA: OTU-like cysteine protease family protein i... 110 2e-22 ref|XP_002445909.1| hypothetical protein SORBIDRAFT_07g027850 [S... 110 2e-22 >ref|XP_004135307.1| PREDICTED: OTU domain-containing protein At3g57810-like [Cucumis sativus] gi|449494889|ref|XP_004159675.1| PREDICTED: OTU domain-containing protein At3g57810-like [Cucumis sativus] Length = 145 Score = 118 bits (296), Expect = 4e-25 Identities = 52/71 (73%), Positives = 62/71 (87%) Frame = -3 Query: 415 YVTHMRHPHVWGGEPELLMASHVLQMPINVCILDGKSGSLRIIAEYGQGYRKENPIHVLY 236 YV HMR PHVWGGEPELLM+SHVLQMPI+V + D KSG+L++IAEYGQ Y KENPI VL+ Sbjct: 72 YVRHMRQPHVWGGEPELLMSSHVLQMPISVYMCDKKSGNLKVIAEYGQEYGKENPIRVLF 131 Query: 235 HGYGHYDALRS 203 H YGHYD+L++ Sbjct: 132 HSYGHYDSLKA 142 >ref|XP_002514949.1| OTU domain-containing protein 6B, putative [Ricinus communis] gi|223546000|gb|EEF47503.1| OTU domain-containing protein 6B, putative [Ricinus communis] Length = 167 Score = 116 bits (290), Expect = 2e-24 Identities = 53/73 (72%), Positives = 62/73 (84%) Frame = -3 Query: 415 YVTHMRHPHVWGGEPELLMASHVLQMPINVCILDGKSGSLRIIAEYGQGYRKENPIHVLY 236 YV MR PHVWGGEPELLM+SHVL++PI V + D SGSL++IAEYGQ Y KENPI VLY Sbjct: 88 YVGQMRQPHVWGGEPELLMSSHVLKIPITVYMRDRNSGSLKVIAEYGQEYGKENPICVLY 147 Query: 235 HGYGHYDALRSQS 197 HGYGHYDAL++Q+ Sbjct: 148 HGYGHYDALQNQT 160 >ref|XP_003537539.1| PREDICTED: OTU domain-containing protein At3g57810-like [Glycine max] Length = 156 Score = 114 bits (284), Expect = 1e-23 Identities = 50/74 (67%), Positives = 58/74 (78%) Frame = -3 Query: 415 YVTHMRHPHVWGGEPELLMASHVLQMPINVCILDGKSGSLRIIAEYGQGYRKENPIHVLY 236 Y MR PH+WGGEPELLM+SHVLQMPI V + D S +L++IAEYGQ Y K+NPI V+Y Sbjct: 82 YTVQMRKPHIWGGEPELLMSSHVLQMPITVLMQDKSSSNLKVIAEYGQEYGKDNPIRVIY 141 Query: 235 HGYGHYDALRSQSF 194 HGYGHYDAL SF Sbjct: 142 HGYGHYDALLKSSF 155 >tpg|DAA47952.1| TPA: OTU-like cysteine protease family protein isoform 1 [Zea mays] gi|414869396|tpg|DAA47953.1| TPA: OTU-like cysteine protease family protein isoform 2 [Zea mays] gi|414869397|tpg|DAA47954.1| TPA: OTU-like cysteine protease family protein isoform 3 [Zea mays] Length = 223 Score = 110 bits (274), Expect = 2e-22 Identities = 50/70 (71%), Positives = 57/70 (81%) Frame = -3 Query: 415 YVTHMRHPHVWGGEPELLMASHVLQMPINVCILDGKSGSLRIIAEYGQGYRKENPIHVLY 236 YV+H+R PHVWGGEPEL MASHVLQMPI V + D +G L IAEYGQ Y KE+PI VLY Sbjct: 143 YVSHIREPHVWGGEPELFMASHVLQMPITVYMRDEDAGGLIAIAEYGQQYGKEDPIQVLY 202 Query: 235 HGYGHYDALR 206 HG+GHYDAL+ Sbjct: 203 HGFGHYDALQ 212 >ref|XP_002445909.1| hypothetical protein SORBIDRAFT_07g027850 [Sorghum bicolor] gi|241942259|gb|EES15404.1| hypothetical protein SORBIDRAFT_07g027850 [Sorghum bicolor] Length = 309 Score = 110 bits (274), Expect = 2e-22 Identities = 50/70 (71%), Positives = 57/70 (81%) Frame = -3 Query: 415 YVTHMRHPHVWGGEPELLMASHVLQMPINVCILDGKSGSLRIIAEYGQGYRKENPIHVLY 236 YV+H+R PHVWGGEPEL MASHVLQMPI V + D +G L IAEYGQ Y KE+PI VLY Sbjct: 229 YVSHIREPHVWGGEPELFMASHVLQMPITVYMRDEDAGGLIAIAEYGQQYGKEDPIQVLY 288 Query: 235 HGYGHYDALR 206 HG+GHYDAL+ Sbjct: 289 HGFGHYDALQ 298