BLASTX nr result
ID: Panax21_contig00036101
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00036101 (528 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002526579.1| hypothetical protein RCOM_1603380 [Ricinus c... 48 2e-07 >ref|XP_002526579.1| hypothetical protein RCOM_1603380 [Ricinus communis] gi|223534073|gb|EEF35791.1| hypothetical protein RCOM_1603380 [Ricinus communis] Length = 661 Score = 47.8 bits (112), Expect(2) = 2e-07 Identities = 22/47 (46%), Positives = 30/47 (63%) Frame = -3 Query: 526 LLVSTCQVPKTFFHELVPSETVKVQLNPVINHNFLLPKLSSPTIIMR 386 + VST Q +TFFH+LVPS+TVK+ LNP NF + K+ + R Sbjct: 490 MFVSTRQAAETFFHQLVPSQTVKIHLNPETAENFSVEKVDMQAQVKR 536 Score = 32.3 bits (72), Expect(2) = 2e-07 Identities = 13/33 (39%), Positives = 24/33 (72%), Gaps = 1/33 (3%) Frame = -1 Query: 342 VGVGKSLKPWRKM-ESPIGLIALILTHCLDMGD 247 +G+ K ++PW+K+ + I +I ++L HCL MG+ Sbjct: 548 MGISKLIQPWKKIARTIICMIVILLLHCLYMGN 580