BLASTX nr result
ID: Panax21_contig00036078
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00036078 (590 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK39957.1| unknown [Lotus japonicus] 59 5e-07 ref|XP_003525199.1| PREDICTED: uncharacterized GPI-anchored prot... 58 1e-06 ref|XP_003637786.1| GPI-anchored protein, putative [Medicago tru... 58 1e-06 gb|ACU18611.1| unknown [Glycine max] 58 1e-06 ref|XP_003528967.1| PREDICTED: uncharacterized GPI-anchored prot... 58 1e-06 >gb|AFK39957.1| unknown [Lotus japonicus] Length = 335 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = -1 Query: 590 SDGSNPQSCSLNSDGMPLAVDSSEFNDQSSSPYLHSP 480 +DGS+PQSC+LNSDGMPLAVDSSE DQSSS L P Sbjct: 278 TDGSDPQSCTLNSDGMPLAVDSSEMYDQSSSAKLQGP 314 >ref|XP_003525199.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like [Glycine max] Length = 360 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/37 (70%), Positives = 33/37 (89%) Frame = -1 Query: 590 SDGSNPQSCSLNSDGMPLAVDSSEFNDQSSSPYLHSP 480 ++GS+PQSC+LNSDGMPLAVDSSE +D+SSS L +P Sbjct: 289 TEGSDPQSCTLNSDGMPLAVDSSEMSDESSSTNLQAP 325 >ref|XP_003637786.1| GPI-anchored protein, putative [Medicago truncatula] gi|355503721|gb|AES84924.1| GPI-anchored protein, putative [Medicago truncatula] Length = 336 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = -1 Query: 587 DGSNPQSCSLNSDGMPLAVDSSEFNDQSSSPYL 489 DGS PQSC+LNSDGMPLAVDSSEF DQSSS L Sbjct: 279 DGSKPQSCTLNSDGMPLAVDSSEFYDQSSSTKL 311 >gb|ACU18611.1| unknown [Glycine max] Length = 360 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/37 (70%), Positives = 33/37 (89%) Frame = -1 Query: 590 SDGSNPQSCSLNSDGMPLAVDSSEFNDQSSSPYLHSP 480 ++GS+PQSC+LNSDGMPLAVDSSE +D+SSS L +P Sbjct: 289 TEGSDPQSCTLNSDGMPLAVDSSEMSDESSSTNLQAP 325 >ref|XP_003528967.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like [Glycine max] Length = 342 Score = 57.8 bits (138), Expect = 1e-06 Identities = 28/37 (75%), Positives = 30/37 (81%) Frame = -1 Query: 590 SDGSNPQSCSLNSDGMPLAVDSSEFNDQSSSPYLHSP 480 +DGS PQSCSLNSDGMPLAVDSSE +D SSS L P Sbjct: 284 TDGSYPQSCSLNSDGMPLAVDSSEISDHSSSNNLQPP 320