BLASTX nr result
ID: Panax21_contig00035363
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00035363 (627 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002314187.1| predicted protein [Populus trichocarpa] gi|2... 117 2e-24 tpg|DAA44657.1| TPA: hypothetical protein ZEAMMB73_413571 [Zea m... 114 1e-23 tpg|DAA44654.1| TPA: hypothetical protein ZEAMMB73_413571 [Zea m... 114 1e-23 ref|NP_001148505.1| DHHC zinc finger domain containing protein [... 114 1e-23 gb|ACG31765.1| DHHC zinc finger domain containing protein [Zea m... 114 1e-23 >ref|XP_002314187.1| predicted protein [Populus trichocarpa] gi|222850595|gb|EEE88142.1| predicted protein [Populus trichocarpa] Length = 251 Score = 117 bits (293), Expect = 2e-24 Identities = 51/76 (67%), Positives = 57/76 (75%), Gaps = 5/76 (6%) Frame = -3 Query: 625 LFSLLQVLWQVVFLTWHIYCVCFNITTDEWINWKKYPELQMVVQHQPGTRFI-----NPY 461 LFSLLQV+WQ VF TWH+YC+CFNI TDEWINWKKYPE Q V+Q QPG F NPY Sbjct: 176 LFSLLQVIWQGVFFTWHLYCICFNIRTDEWINWKKYPEFQFVIQSQPGESFTRVMFKNPY 235 Query: 460 DKGILQNLKDFLKAEG 413 D G LQN+K+FL G Sbjct: 236 DNGYLQNVKEFLSVNG 251 >tpg|DAA44657.1| TPA: hypothetical protein ZEAMMB73_413571 [Zea mays] Length = 331 Score = 114 bits (285), Expect = 1e-23 Identities = 49/72 (68%), Positives = 60/72 (83%), Gaps = 2/72 (2%) Frame = -3 Query: 625 LFSLLQVLWQVVFLTWHIYCVCFNITTDEWINWKKYPELQMVVQHQPGT--RFINPYDKG 452 LFS+LQVLWQ+VFL WHIYC+CFNI TDEWINWKKYPE QM Q + + +F+NPYDKG Sbjct: 260 LFSILQVLWQIVFLMWHIYCICFNIKTDEWINWKKYPEFQMKEQPRSDSEVKFVNPYDKG 319 Query: 451 ILQNLKDFLKAE 416 +L N+++FLK E Sbjct: 320 MLCNIREFLKPE 331 >tpg|DAA44654.1| TPA: hypothetical protein ZEAMMB73_413571 [Zea mays] Length = 300 Score = 114 bits (285), Expect = 1e-23 Identities = 49/72 (68%), Positives = 60/72 (83%), Gaps = 2/72 (2%) Frame = -3 Query: 625 LFSLLQVLWQVVFLTWHIYCVCFNITTDEWINWKKYPELQMVVQHQPGT--RFINPYDKG 452 LFS+LQVLWQ+VFL WHIYC+CFNI TDEWINWKKYPE QM Q + + +F+NPYDKG Sbjct: 229 LFSILQVLWQIVFLMWHIYCICFNIKTDEWINWKKYPEFQMKEQPRSDSEVKFVNPYDKG 288 Query: 451 ILQNLKDFLKAE 416 +L N+++FLK E Sbjct: 289 MLCNIREFLKPE 300 >ref|NP_001148505.1| DHHC zinc finger domain containing protein [Zea mays] gi|223945801|gb|ACN26984.1| unknown [Zea mays] gi|414866098|tpg|DAA44655.1| TPA: DHHC zinc finger domain containing protein [Zea mays] Length = 315 Score = 114 bits (285), Expect = 1e-23 Identities = 49/72 (68%), Positives = 60/72 (83%), Gaps = 2/72 (2%) Frame = -3 Query: 625 LFSLLQVLWQVVFLTWHIYCVCFNITTDEWINWKKYPELQMVVQHQPGT--RFINPYDKG 452 LFS+LQVLWQ+VFL WHIYC+CFNI TDEWINWKKYPE QM Q + + +F+NPYDKG Sbjct: 244 LFSILQVLWQIVFLMWHIYCICFNIKTDEWINWKKYPEFQMKEQPRSDSEVKFVNPYDKG 303 Query: 451 ILQNLKDFLKAE 416 +L N+++FLK E Sbjct: 304 MLCNIREFLKPE 315 >gb|ACG31765.1| DHHC zinc finger domain containing protein [Zea mays] Length = 315 Score = 114 bits (285), Expect = 1e-23 Identities = 49/72 (68%), Positives = 60/72 (83%), Gaps = 2/72 (2%) Frame = -3 Query: 625 LFSLLQVLWQVVFLTWHIYCVCFNITTDEWINWKKYPELQMVVQHQPGT--RFINPYDKG 452 LFS+LQVLWQ+VFL WHIYC+CFNI TDEWINWKKYPE QM Q + + +F+NPYDKG Sbjct: 244 LFSILQVLWQIVFLMWHIYCICFNIKTDEWINWKKYPEFQMKEQPRSDSEVKFVNPYDKG 303 Query: 451 ILQNLKDFLKAE 416 +L N+++FLK E Sbjct: 304 MLCNIREFLKPE 315