BLASTX nr result
ID: Panax21_contig00034977
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00034977 (364 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEQ29018.1| WRKY5 [Panax quinquefolius] 72 4e-11 >gb|AEQ29018.1| WRKY5 [Panax quinquefolius] Length = 219 Score = 72.4 bits (176), Expect = 4e-11 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +1 Query: 265 MEYYNRFVHDQDDSPETASGSPLSGEDTIMADT 363 MEYYNRFVHDQDDSPETASGSPLSGEDTIMADT Sbjct: 1 MEYYNRFVHDQDDSPETASGSPLSGEDTIMADT 33