BLASTX nr result
ID: Panax21_contig00034814
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00034814 (478 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI28269.3| unnamed protein product [Vitis vinifera] 58 9e-07 ref|XP_002272473.1| PREDICTED: transcription factor E2FB-like [V... 58 9e-07 >emb|CBI28269.3| unnamed protein product [Vitis vinifera] Length = 446 Score = 57.8 bits (138), Expect = 9e-07 Identities = 28/40 (70%), Positives = 31/40 (77%), Gaps = 4/40 (10%) Frame = -1 Query: 478 TESGVEWNELEPLNDDYTIANVSTP----PPSSTAEMPSA 371 TE GVEWNEL+ LNDDY +ANVSTP PPSS AE+P A Sbjct: 401 TEPGVEWNELDALNDDYAMANVSTPQPQTPPSSAAEVPPA 440 >ref|XP_002272473.1| PREDICTED: transcription factor E2FB-like [Vitis vinifera] Length = 457 Score = 57.8 bits (138), Expect = 9e-07 Identities = 28/40 (70%), Positives = 31/40 (77%), Gaps = 4/40 (10%) Frame = -1 Query: 478 TESGVEWNELEPLNDDYTIANVSTP----PPSSTAEMPSA 371 TE GVEWNEL+ LNDDY +ANVSTP PPSS AE+P A Sbjct: 412 TEPGVEWNELDALNDDYAMANVSTPQPQTPPSSAAEVPPA 451