BLASTX nr result
ID: Panax21_contig00034708
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00034708 (503 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517698.1| homoserine kinase, putative [Ricinus communi... 40 8e-07 >ref|XP_002517698.1| homoserine kinase, putative [Ricinus communis] gi|223543330|gb|EEF44862.1| homoserine kinase, putative [Ricinus communis] Length = 367 Score = 40.0 bits (92), Expect(2) = 8e-07 Identities = 23/43 (53%), Positives = 25/43 (58%) Frame = -3 Query: 276 CAVDYLDDFVTPPVDAHVHPSPSEISIFEINSRQFFKKAQQRP 148 CAVD L DFVT VD VH P EISI EI+ KK + P Sbjct: 68 CAVDGLGDFVTVTVDPSVH--PGEISIAEISGTHASKKLSKNP 108 Score = 37.7 bits (86), Expect(2) = 8e-07 Identities = 18/27 (66%), Positives = 23/27 (85%) Frame = -1 Query: 140 NRAGIAVISIMRMLNIRSVGMSLSLHK 60 N AGIA I+ M+MLN+RSVG+SL+L K Sbjct: 111 NCAGIAGIATMKMLNVRSVGLSLTLEK 137