BLASTX nr result
ID: Panax21_contig00034690
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00034690 (388 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004166129.1| PREDICTED: LOW QUALITY PROTEIN: chromodomain... 72 6e-11 ref|XP_004140512.1| PREDICTED: chromodomain-helicase-DNA-binding... 72 6e-11 ref|XP_003517934.1| PREDICTED: chromodomain-helicase-DNA-binding... 69 4e-10 ref|NP_973689.2| SNF2 and helicase domain-containing protein [Ar... 68 7e-10 ref|XP_002881993.1| hypothetical protein ARALYDRAFT_483627 [Arab... 67 1e-09 >ref|XP_004166129.1| PREDICTED: LOW QUALITY PROTEIN: chromodomain-helicase-DNA-binding protein 1-like [Cucumis sativus] Length = 867 Score = 71.6 bits (174), Expect = 6e-11 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = +1 Query: 1 GYQDGSDRSEWYTVERLLRKYAAIYGVKIFVYYFR 105 GYQDGSDRSEWYTVERLLRKYA+IY VKI+VYY+R Sbjct: 830 GYQDGSDRSEWYTVERLLRKYASIYNVKIYVYYYR 864 >ref|XP_004140512.1| PREDICTED: chromodomain-helicase-DNA-binding protein 1-like [Cucumis sativus] Length = 868 Score = 71.6 bits (174), Expect = 6e-11 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = +1 Query: 1 GYQDGSDRSEWYTVERLLRKYAAIYGVKIFVYYFR 105 GYQDGSDRSEWYTVERLLRKYA+IY VKI+VYY+R Sbjct: 831 GYQDGSDRSEWYTVERLLRKYASIYNVKIYVYYYR 865 >ref|XP_003517934.1| PREDICTED: chromodomain-helicase-DNA-binding protein 1-like [Glycine max] Length = 1482 Score = 68.9 bits (167), Expect = 4e-10 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = +1 Query: 1 GYQDGSDRSEWYTVERLLRKYAAIYGVKIFVYYFR 105 GYQDGSDRSEWYT+ERLLRKYA+IY + I+VYY+R Sbjct: 1445 GYQDGSDRSEWYTIERLLRKYASIYNINIYVYYYR 1479 >ref|NP_973689.2| SNF2 and helicase domain-containing protein [Arabidopsis thaliana] gi|330255399|gb|AEC10493.1| SNF2 and helicase domain-containing protein [Arabidopsis thaliana] Length = 877 Score = 68.2 bits (165), Expect = 7e-10 Identities = 29/35 (82%), Positives = 34/35 (97%) Frame = +1 Query: 1 GYQDGSDRSEWYTVERLLRKYAAIYGVKIFVYYFR 105 GYQDGSDRS+WYTVERLLRKY++I+ VKIFVYY+R Sbjct: 840 GYQDGSDRSQWYTVERLLRKYSSIFTVKIFVYYYR 874 >ref|XP_002881993.1| hypothetical protein ARALYDRAFT_483627 [Arabidopsis lyrata subsp. lyrata] gi|297327832|gb|EFH58252.1| hypothetical protein ARALYDRAFT_483627 [Arabidopsis lyrata subsp. lyrata] Length = 873 Score = 67.0 bits (162), Expect = 1e-09 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = +1 Query: 1 GYQDGSDRSEWYTVERLLRKYAAIYGVKIFVYYFR 105 GYQDGSDRS+WYTVERLL KY++I+ VKIFVYY+R Sbjct: 836 GYQDGSDRSQWYTVERLLHKYSSIFAVKIFVYYYR 870