BLASTX nr result
ID: Panax21_contig00034620
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00034620 (572 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABD63183.1| hypothetical protein 20.t00035 [Asparagus officin... 56 5e-06 >gb|ABD63183.1| hypothetical protein 20.t00035 [Asparagus officinalis] Length = 210 Score = 55.8 bits (133), Expect = 5e-06 Identities = 33/97 (34%), Positives = 49/97 (50%) Frame = -1 Query: 560 YQIPKTHQLKAPSTSERMYF*SNGWTTMPLTLLEKGVGLPLHPFIITLLGFISVGFAQLV 381 Y I +T L AP SE +Y + L LE G+ LPLHPFI + + V Q Sbjct: 37 YNISQTLTLVAPEISEPVYCHGEDQVPLYLAHLEHGLRLPLHPFIKEVHTALGVSPFQFY 96 Query: 380 PNSYINIIAFISFFHEAGIPPSIDFFFSLYQLGNSQE 270 PN+ ++AFI H G+ PS+ L +G++++ Sbjct: 97 PNTVGILVAFIIICHRVGVQPSLRLLGHLIGVGSAEK 133