BLASTX nr result
ID: Panax21_contig00034587
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00034587 (464 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511829.1| conserved hypothetical protein [Ricinus comm... 112 2e-23 emb|CAN74802.1| hypothetical protein VITISV_006289 [Vitis vinifera] 111 4e-23 emb|CBI40314.3| unnamed protein product [Vitis vinifera] 111 4e-23 ref|XP_002272448.2| PREDICTED: uncharacterized protein LOC100253... 111 4e-23 ref|XP_003529953.1| PREDICTED: uncharacterized protein LOC100790... 110 2e-22 >ref|XP_002511829.1| conserved hypothetical protein [Ricinus communis] gi|223549009|gb|EEF50498.1| conserved hypothetical protein [Ricinus communis] Length = 607 Score = 112 bits (279), Expect(2) = 2e-23 Identities = 51/61 (83%), Positives = 58/61 (95%) Frame = +2 Query: 218 DMHNCVMKKRVNPQRRREKVYVGCGAGFGGDQPLAALKLLQRVKELNYLVLECLAERTLS 397 D+HNCV+K R NP+RRREKVY+GCGAGFGGD+P AALKLL+RVKELNYLVLECLAERTL+ Sbjct: 8 DIHNCVIKLRKNPERRREKVYIGCGAGFGGDRPSAALKLLERVKELNYLVLECLAERTLA 67 Query: 398 D 400 D Sbjct: 68 D 68 Score = 21.9 bits (45), Expect(2) = 2e-23 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = +1 Query: 412 VFGGDGFDPRI 444 + GGDGFD RI Sbjct: 74 ISGGDGFDSRI 84 >emb|CAN74802.1| hypothetical protein VITISV_006289 [Vitis vinifera] Length = 705 Score = 111 bits (278), Expect(2) = 4e-23 Identities = 51/61 (83%), Positives = 59/61 (96%) Frame = +2 Query: 218 DMHNCVMKKRVNPQRRREKVYVGCGAGFGGDQPLAALKLLQRVKELNYLVLECLAERTLS 397 ++H+CV+K RVNPQRR EKVY+GCGAGFGGD+PLAALKLLQRVKELNYLVLECLAERTL+ Sbjct: 32 EVHDCVIKLRVNPQRRSEKVYIGCGAGFGGDRPLAALKLLQRVKELNYLVLECLAERTLA 91 Query: 398 D 400 + Sbjct: 92 E 92 Score = 21.2 bits (43), Expect(2) = 4e-23 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = +1 Query: 412 VFGGDGFDPRI 444 V GGDG+D RI Sbjct: 98 VSGGDGYDSRI 108 >emb|CBI40314.3| unnamed protein product [Vitis vinifera] Length = 646 Score = 111 bits (278), Expect(2) = 4e-23 Identities = 51/61 (83%), Positives = 59/61 (96%) Frame = +2 Query: 218 DMHNCVMKKRVNPQRRREKVYVGCGAGFGGDQPLAALKLLQRVKELNYLVLECLAERTLS 397 ++H+CV+K RVNPQRR EKVY+GCGAGFGGD+PLAALKLLQRVKELNYLVLECLAERTL+ Sbjct: 8 EVHDCVIKLRVNPQRRSEKVYIGCGAGFGGDRPLAALKLLQRVKELNYLVLECLAERTLA 67 Query: 398 D 400 + Sbjct: 68 E 68 Score = 21.2 bits (43), Expect(2) = 4e-23 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = +1 Query: 412 VFGGDGFDPRI 444 V GGDG+D RI Sbjct: 74 VSGGDGYDSRI 84 >ref|XP_002272448.2| PREDICTED: uncharacterized protein LOC100253419 [Vitis vinifera] Length = 641 Score = 111 bits (278), Expect(2) = 4e-23 Identities = 51/61 (83%), Positives = 59/61 (96%) Frame = +2 Query: 218 DMHNCVMKKRVNPQRRREKVYVGCGAGFGGDQPLAALKLLQRVKELNYLVLECLAERTLS 397 ++H+CV+K RVNPQRR EKVY+GCGAGFGGD+PLAALKLLQRVKELNYLVLECLAERTL+ Sbjct: 8 EVHDCVIKLRVNPQRRSEKVYIGCGAGFGGDRPLAALKLLQRVKELNYLVLECLAERTLA 67 Query: 398 D 400 + Sbjct: 68 E 68 Score = 21.2 bits (43), Expect(2) = 4e-23 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = +1 Query: 412 VFGGDGFDPRI 444 V GGDG+D RI Sbjct: 74 VSGGDGYDSRI 84 >ref|XP_003529953.1| PREDICTED: uncharacterized protein LOC100790647 [Glycine max] Length = 644 Score = 110 bits (274), Expect = 2e-22 Identities = 49/61 (80%), Positives = 59/61 (96%) Frame = +2 Query: 218 DMHNCVMKKRVNPQRRREKVYVGCGAGFGGDQPLAALKLLQRVKELNYLVLECLAERTLS 397 ++HNC++K R NP+RRR+KVY+GCGAGFGGD+PLAALKLLQRV+ELNYLVLECLAERTL+ Sbjct: 8 EIHNCLIKLRSNPERRRDKVYIGCGAGFGGDKPLAALKLLQRVQELNYLVLECLAERTLA 67 Query: 398 D 400 D Sbjct: 68 D 68