BLASTX nr result
ID: Panax21_contig00034520
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00034520 (423 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEQ29022.1| WRKY9 [Panax quinquefolius] 103 1e-20 gb|AEQ29019.1| WRKY6 [Panax quinquefolius] 102 4e-20 ref|XP_002511908.1| WRKY transcription factor, putative [Ricinus... 55 6e-06 >gb|AEQ29022.1| WRKY9 [Panax quinquefolius] Length = 346 Score = 103 bits (258), Expect = 1e-20 Identities = 54/55 (98%), Positives = 54/55 (98%) Frame = -3 Query: 166 MEILGMDCEQKSLINIELTQGKELANQLKNQLDQKSSGEEICEGLVEKILSSYEK 2 MEILGMDCEQKSLINIELTQGKELANQLKNQLDQK SGEEICEGLVEKILSSYEK Sbjct: 1 MEILGMDCEQKSLINIELTQGKELANQLKNQLDQK-SGEEICEGLVEKILSSYEK 54 >gb|AEQ29019.1| WRKY6 [Panax quinquefolius] Length = 346 Score = 102 bits (253), Expect = 4e-20 Identities = 53/55 (96%), Positives = 54/55 (98%) Frame = -3 Query: 166 MEILGMDCEQKSLINIELTQGKELANQLKNQLDQKSSGEEICEGLVEKILSSYEK 2 MEILGMDCEQKSLINIELTQGKELANQLK+QLDQK SGEEICEGLVEKILSSYEK Sbjct: 1 MEILGMDCEQKSLINIELTQGKELANQLKSQLDQK-SGEEICEGLVEKILSSYEK 54 >ref|XP_002511908.1| WRKY transcription factor, putative [Ricinus communis] gi|223549088|gb|EEF50577.1| WRKY transcription factor, putative [Ricinus communis] Length = 333 Score = 55.1 bits (131), Expect = 6e-06 Identities = 33/50 (66%), Positives = 40/50 (80%) Frame = -3 Query: 151 MDCEQKSLINIELTQGKELANQLKNQLDQKSSGEEICEGLVEKILSSYEK 2 M+ EQK L+N ELTQGKELA QL+N L+ SS E+ +GLVE+ILSSYEK Sbjct: 1 MEREQKILVN-ELTQGKELAEQLRNHLNNISS-FEMRQGLVEQILSSYEK 48