BLASTX nr result
ID: Panax21_contig00034460
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00034460 (402 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002891076.1| predicted protein [Arabidopsis lyrata subsp.... 89 4e-16 ref|XP_002524355.1| choline/ethanolamine kinase, putative [Ricin... 89 4e-16 dbj|BAJ34184.1| unnamed protein product [Thellungiella halophila] 87 1e-15 ref|XP_002874587.1| hypothetical protein ARALYDRAFT_911244 [Arab... 87 1e-15 ref|NP_192714.1| protein kinase family protein [Arabidopsis thal... 87 1e-15 >ref|XP_002891076.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297336918|gb|EFH67335.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 352 Score = 89.0 bits (219), Expect = 4e-16 Identities = 37/45 (82%), Positives = 42/45 (93%) Frame = +2 Query: 263 MDYEYASYNLVAYDLANHFCEMATNYHSETPHILDYSIYPGSEER 397 +DYEYASYN VAYD+ANHFCEMA NYHS+TPHILDY++YPG EER Sbjct: 223 IDYEYASYNPVAYDIANHFCEMAANYHSKTPHILDYTLYPGEEER 267 >ref|XP_002524355.1| choline/ethanolamine kinase, putative [Ricinus communis] gi|223536446|gb|EEF38095.1| choline/ethanolamine kinase, putative [Ricinus communis] Length = 356 Score = 89.0 bits (219), Expect = 4e-16 Identities = 37/46 (80%), Positives = 42/46 (91%) Frame = +2 Query: 263 MDYEYASYNLVAYDLANHFCEMATNYHSETPHILDYSIYPGSEERK 400 +DYEYASYN +AYD+ANHFCEMA NYHSETPH+LDYS YPG EER+ Sbjct: 223 IDYEYASYNPIAYDIANHFCEMAANYHSETPHVLDYSKYPGLEERR 268 >dbj|BAJ34184.1| unnamed protein product [Thellungiella halophila] Length = 348 Score = 87.0 bits (214), Expect = 1e-15 Identities = 34/46 (73%), Positives = 42/46 (91%) Frame = +2 Query: 263 MDYEYASYNLVAYDLANHFCEMATNYHSETPHILDYSIYPGSEERK 400 +DYEYASYN +AYD+ANHFCEM NYHS+TPHILDY++YPG E+R+ Sbjct: 223 IDYEYASYNPIAYDIANHFCEMVANYHSDTPHILDYTLYPGEEDRR 268 >ref|XP_002874587.1| hypothetical protein ARALYDRAFT_911244 [Arabidopsis lyrata subsp. lyrata] gi|297320424|gb|EFH50846.1| hypothetical protein ARALYDRAFT_911244 [Arabidopsis lyrata subsp. lyrata] Length = 342 Score = 87.0 bits (214), Expect = 1e-15 Identities = 35/46 (76%), Positives = 42/46 (91%) Frame = +2 Query: 263 MDYEYASYNLVAYDLANHFCEMATNYHSETPHILDYSIYPGSEERK 400 +DYEYASYN +AYD+ANHFCEMA +YHS TPHILDY++YPG EER+ Sbjct: 223 IDYEYASYNPIAYDIANHFCEMAADYHSNTPHILDYTLYPGEEERR 268 >ref|NP_192714.1| protein kinase family protein [Arabidopsis thaliana] gi|30681187|ref|NP_849350.1| protein kinase family protein [Arabidopsis thaliana] gi|4538906|emb|CAB39643.1| choline kinase GmCK2p-like protein [Arabidopsis thaliana] gi|7267671|emb|CAB78099.1| choline kinase GmCK2p-like protein [Arabidopsis thaliana] gi|332657392|gb|AEE82792.1| protein kinase family protein [Arabidopsis thaliana] gi|332657393|gb|AEE82793.1| protein kinase family protein [Arabidopsis thaliana] Length = 346 Score = 87.0 bits (214), Expect = 1e-15 Identities = 35/46 (76%), Positives = 42/46 (91%) Frame = +2 Query: 263 MDYEYASYNLVAYDLANHFCEMATNYHSETPHILDYSIYPGSEERK 400 +DYEYASYN +AYD+ANHFCEMA +YHS TPHILDY++YPG EER+ Sbjct: 223 IDYEYASYNPIAYDIANHFCEMAADYHSNTPHILDYTLYPGEEERR 268