BLASTX nr result
ID: Panax21_contig00034397
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00034397 (627 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511875.1| cytochrome P450, putative [Ricinus communis]... 67 3e-09 emb|CBI40391.3| unnamed protein product [Vitis vinifera] 66 6e-09 ref|XP_002275115.1| PREDICTED: cytochrome P450 86A2 [Vitis vinif... 66 6e-09 ref|XP_004138498.1| PREDICTED: cytochrome P450 86A2-like [Cucumi... 64 2e-08 ref|XP_003627566.1| Cytochrome P450 fatty acid omega-hydroxylase... 63 5e-08 >ref|XP_002511875.1| cytochrome P450, putative [Ricinus communis] gi|223549055|gb|EEF50544.1| cytochrome P450, putative [Ricinus communis] Length = 522 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/47 (63%), Positives = 38/47 (80%) Frame = -2 Query: 143 VIYIYKSMDIIMTTVVLLLFTAYLLWFTFISRSLKGPRVWPLLGSLP 3 ++++Y +MD+ ++ TAYLLWFTFISRSLKGPRVWPLLGSLP Sbjct: 2 LVFVY-TMDVSTALMLFSAVTAYLLWFTFISRSLKGPRVWPLLGSLP 47 >emb|CBI40391.3| unnamed protein product [Vitis vinifera] Length = 524 Score = 65.9 bits (159), Expect = 6e-09 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = -2 Query: 122 MDIIMTTVVLLLFTAYLLWFTFISRSLKGPRVWPLLGSLP 3 MD+ ++ + TAYLLWFTFISRSL+GPRVWPLLGSLP Sbjct: 1 MDVFWASLFFMAITAYLLWFTFISRSLRGPRVWPLLGSLP 40 >ref|XP_002275115.1| PREDICTED: cytochrome P450 86A2 [Vitis vinifera] Length = 558 Score = 65.9 bits (159), Expect = 6e-09 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = -2 Query: 122 MDIIMTTVVLLLFTAYLLWFTFISRSLKGPRVWPLLGSLP 3 MD+ ++ + TAYLLWFTFISRSL+GPRVWPLLGSLP Sbjct: 1 MDVFWASLFFMAITAYLLWFTFISRSLRGPRVWPLLGSLP 40 >ref|XP_004138498.1| PREDICTED: cytochrome P450 86A2-like [Cucumis sativus] gi|449495315|ref|XP_004159797.1| PREDICTED: cytochrome P450 86A2-like [Cucumis sativus] Length = 547 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = -2 Query: 122 MDIIMTTVVLLLFTAYLLWFTFISRSLKGPRVWPLLGSLP 3 MD+ V++ TAYLLWFTFISRSLKGP++WPLLGSLP Sbjct: 1 MDVGFALVIVTAVTAYLLWFTFISRSLKGPQMWPLLGSLP 40 >ref|XP_003627566.1| Cytochrome P450 fatty acid omega-hydroxylase [Medicago truncatula] gi|355521588|gb|AET02042.1| Cytochrome P450 fatty acid omega-hydroxylase [Medicago truncatula] Length = 540 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/40 (70%), Positives = 32/40 (80%) Frame = -2 Query: 122 MDIIMTTVVLLLFTAYLLWFTFISRSLKGPRVWPLLGSLP 3 M+ ++L TAYLLWFTFISRSL+GPRVWPLLGSLP Sbjct: 1 METCTALLLLTAITAYLLWFTFISRSLRGPRVWPLLGSLP 40