BLASTX nr result
ID: Panax21_contig00034374
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00034374 (484 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004143816.1| PREDICTED: probable ADP-ribosylation factor ... 63 3e-08 ref|XP_002882559.1| hypothetical protein ARALYDRAFT_478135 [Arab... 61 8e-08 emb|CBI40178.3| unnamed protein product [Vitis vinifera] 61 8e-08 ref|NP_187451.2| putative ADP-ribosylation factor GTPase-activat... 60 1e-07 ref|XP_002270290.1| PREDICTED: probable ADP-ribosylation factor ... 60 2e-07 >ref|XP_004143816.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating protein AGD11-like [Cucumis sativus] Length = 416 Score = 62.8 bits (151), Expect = 3e-08 Identities = 33/78 (42%), Positives = 46/78 (58%), Gaps = 17/78 (21%) Frame = +1 Query: 301 EQNMDPTTNSGPCLYDLL------------RLDPNYKTRNASFQQS-----PQDRLKNLL 429 +QN D SG CL+DLL R+ + +T+ ++++ PQ RL++LL Sbjct: 5 QQNSDSNGVSGACLFDLLFPDSEMQGWDWSRMPSDSETQRWNWKKDQRLSGPQKRLEDLL 64 Query: 430 SESGNKFCADCGSPDPKW 483 +SGN FCADCGSPDPKW Sbjct: 65 QQSGNMFCADCGSPDPKW 82 >ref|XP_002882559.1| hypothetical protein ARALYDRAFT_478135 [Arabidopsis lyrata subsp. lyrata] gi|297328399|gb|EFH58818.1| hypothetical protein ARALYDRAFT_478135 [Arabidopsis lyrata subsp. lyrata] Length = 383 Score = 61.2 bits (147), Expect = 8e-08 Identities = 31/66 (46%), Positives = 42/66 (63%), Gaps = 5/66 (7%) Frame = +1 Query: 301 EQNMDPTTNSGP--CLYDLLRLDPNYKTRNASFQQS---PQDRLKNLLSESGNKFCADCG 465 ++N++P SG CLY+LL + T Q S P+DRL+ LL + GNK+CADCG Sbjct: 5 QENVEPVEVSGSHACLYELLCSETPKWTPLKDLQTSSSDPRDRLEKLLKQPGNKYCADCG 64 Query: 466 SPDPKW 483 SP+PKW Sbjct: 65 SPEPKW 70 >emb|CBI40178.3| unnamed protein product [Vitis vinifera] Length = 414 Score = 61.2 bits (147), Expect = 8e-08 Identities = 34/71 (47%), Positives = 40/71 (56%), Gaps = 6/71 (8%) Frame = +1 Query: 289 GLKCEQNMDPT-----TNSGPCLYDLLRLDPNYKTRNASFQQS-PQDRLKNLLSESGNKF 450 GLK D T + +G L DLLR D + R S P+ RL+NLL +SGN Sbjct: 36 GLKMPTRQDNTDSNNGSGTGSSLLDLLRSDIYWNCRKEGQTSSGPRGRLENLLCQSGNNI 95 Query: 451 CADCGSPDPKW 483 CADCGSPDPKW Sbjct: 96 CADCGSPDPKW 106 >ref|NP_187451.2| putative ADP-ribosylation factor GTPase-activating protein AGD11 [Arabidopsis thaliana] gi|75154127|sp|Q8L7A4.1|AGD11_ARATH RecName: Full=Probable ADP-ribosylation factor GTPase-activating protein AGD11; Short=ARF GAP AGD11; AltName: Full=Protein ARF-GAP DOMAIN 11; Short=AtAGD11 gi|22531086|gb|AAM97047.1| putative GTPase-activating protein [Arabidopsis thaliana] gi|25083805|gb|AAN72120.1| putative GTPase-activating protein [Arabidopsis thaliana] gi|332641102|gb|AEE74623.1| putative ADP-ribosylation factor GTPase-activating protein AGD11 [Arabidopsis thaliana] Length = 385 Score = 60.5 bits (145), Expect = 1e-07 Identities = 33/68 (48%), Positives = 43/68 (63%), Gaps = 7/68 (10%) Frame = +1 Query: 301 EQNMDPTTNSGP--CLYDLLRLDPNYKT--RNASFQQS---PQDRLKNLLSESGNKFCAD 459 ++N+DP SG CLY+LL + T R Q S P+DRL+ LL + GNK+CAD Sbjct: 5 QENVDPVEVSGSHACLYELLCSETPKWTPLRVEDLQTSSSDPRDRLEKLLKQPGNKYCAD 64 Query: 460 CGSPDPKW 483 CGSP+PKW Sbjct: 65 CGSPEPKW 72 >ref|XP_002270290.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating protein AGD11-like [Vitis vinifera] Length = 376 Score = 59.7 bits (143), Expect = 2e-07 Identities = 32/64 (50%), Positives = 37/64 (57%), Gaps = 3/64 (4%) Frame = +1 Query: 301 EQNMDPTTNSGP--CLYDLLRLDPNYKTRNASFQQS-PQDRLKNLLSESGNKFCADCGSP 471 + N D SG L DLLR D + R S P+ RL+NLL +SGN CADCGSP Sbjct: 5 QDNTDSNNGSGTGSSLLDLLRSDIYWNCRKEGQTSSGPRGRLENLLCQSGNNICADCGSP 64 Query: 472 DPKW 483 DPKW Sbjct: 65 DPKW 68