BLASTX nr result
ID: Panax21_contig00034347
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00034347 (379 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004140490.1| PREDICTED: probable plastid-lipid-associated... 71 8e-11 ref|XP_003580284.1| PREDICTED: probable plastid-lipid-associated... 66 3e-09 dbj|BAK05444.1| predicted protein [Hordeum vulgare subsp. vulgare] 66 3e-09 ref|NP_191914.1| putative plastid-lipid-associated protein 11 [A... 65 4e-09 gb|EEE61457.1| hypothetical protein OsJ_15704 [Oryza sativa Japo... 65 6e-09 >ref|XP_004140490.1| PREDICTED: probable plastid-lipid-associated protein 11, chloroplastic-like [Cucumis sativus] Length = 213 Score = 71.2 bits (173), Expect = 8e-11 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = +3 Query: 9 GWFDTVYLDNEIRVVKDTRGDYLVVDRAPYSWTE 110 GWFDTVYLD+EIRVVKD RGDYL+V+RAPYSWTE Sbjct: 180 GWFDTVYLDDEIRVVKDIRGDYLIVERAPYSWTE 213 >ref|XP_003580284.1| PREDICTED: probable plastid-lipid-associated protein 11, chloroplastic-like [Brachypodium distachyon] Length = 221 Score = 66.2 bits (160), Expect = 3e-09 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +3 Query: 9 GWFDTVYLDNEIRVVKDTRGDYLVVDRAPYSW 104 GWFDTVYLD+EIRV KD RGDYLVV+RAPYSW Sbjct: 188 GWFDTVYLDDEIRVAKDIRGDYLVVERAPYSW 219 >dbj|BAK05444.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 222 Score = 66.2 bits (160), Expect = 3e-09 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +3 Query: 9 GWFDTVYLDNEIRVVKDTRGDYLVVDRAPYSW 104 GWFDTVYLD+EIRV KD RGDYLVV+RAPYSW Sbjct: 189 GWFDTVYLDDEIRVAKDIRGDYLVVERAPYSW 220 >ref|NP_191914.1| putative plastid-lipid-associated protein 11 [Arabidopsis thaliana] gi|75100154|sp|O81304.1|PAP11_ARATH RecName: Full=Probable plastid-lipid-associated protein 11, chloroplastic; AltName: Full=Fibrillin-11; Flags: Precursor gi|3193328|gb|AAC19310.1| F6N15.13 gene product [Arabidopsis thaliana] gi|7267090|emb|CAB80761.1| predicted protein of unknown function [Arabidopsis thaliana] gi|15809917|gb|AAL06886.1| AT4g00030/F6N15_13 [Arabidopsis thaliana] gi|18377823|gb|AAL67098.1| AT4g00030/F6N15_13 [Arabidopsis thaliana] gi|332656416|gb|AEE81816.1| putative plastid-lipid-associated protein 11 [Arabidopsis thaliana] Length = 212 Score = 65.5 bits (158), Expect = 4e-09 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = +3 Query: 9 GWFDTVYLDNEIRVVKDTRGDYLVVDRAPYSWTE 110 GWF+ VY+D EIRV KD RGDYL+VDRAPY+WTE Sbjct: 176 GWFENVYMDGEIRVAKDIRGDYLIVDRAPYNWTE 209 >gb|EEE61457.1| hypothetical protein OsJ_15704 [Oryza sativa Japonica Group] Length = 228 Score = 65.1 bits (157), Expect = 6e-09 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +3 Query: 9 GWFDTVYLDNEIRVVKDTRGDYLVVDRAPYSW 104 GWFDTVYLD++IRV KD RGDYLVV+RAPYSW Sbjct: 195 GWFDTVYLDDDIRVAKDIRGDYLVVERAPYSW 226 Score = 54.7 bits (130), Expect = 8e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = +3 Query: 153 FDTVYVDGDIRVAKDIRGDYLVVDRDPLKW 242 FDTVY+D DIRVAKDIRGDYLVV+R P W Sbjct: 197 FDTVYLDDDIRVAKDIRGDYLVVERAPYSW 226