BLASTX nr result
ID: Panax21_contig00034301
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00034301 (578 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003573371.1| PREDICTED: vesicle-associated protein 4-2-li... 59 8e-07 ref|XP_003562897.1| PREDICTED: vesicle-associated protein 4-2-li... 59 8e-07 ref|XP_002275178.2| PREDICTED: vesicle-associated protein 4-2 [V... 58 1e-06 ref|XP_002443837.1| hypothetical protein SORBIDRAFT_07g003060 [S... 58 1e-06 ref|XP_002274772.1| PREDICTED: vesicle-associated protein 4-2-li... 58 1e-06 >ref|XP_003573371.1| PREDICTED: vesicle-associated protein 4-2-like [Brachypodium distachyon] Length = 235 Score = 58.5 bits (140), Expect = 8e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +1 Query: 1 RVVGEGLVIDEWKERRERYLAWQQVERVDSV 93 R+VGEGLVIDEWKERRERYLA QQVE VDSV Sbjct: 205 RIVGEGLVIDEWKERRERYLARQQVEGVDSV 235 >ref|XP_003562897.1| PREDICTED: vesicle-associated protein 4-2-like [Brachypodium distachyon] Length = 267 Score = 58.5 bits (140), Expect = 8e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +1 Query: 1 RVVGEGLVIDEWKERRERYLAWQQVERVDSV 93 R+VGEGLVIDEWKERRERYLA QQVE VDSV Sbjct: 237 RIVGEGLVIDEWKERRERYLAQQQVEVVDSV 267 >ref|XP_002275178.2| PREDICTED: vesicle-associated protein 4-2 [Vitis vinifera] gi|297745648|emb|CBI40859.3| unnamed protein product [Vitis vinifera] Length = 264 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +1 Query: 1 RVVGEGLVIDEWKERRERYLAWQQVERVDSV 93 R++GEGLVIDEWKERRERYLA QQVE VDSV Sbjct: 234 RIIGEGLVIDEWKERRERYLARQQVEGVDSV 264 >ref|XP_002443837.1| hypothetical protein SORBIDRAFT_07g003060 [Sorghum bicolor] gi|241940187|gb|EES13332.1| hypothetical protein SORBIDRAFT_07g003060 [Sorghum bicolor] Length = 235 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +1 Query: 1 RVVGEGLVIDEWKERRERYLAWQQVERVDSV 93 R+VGEGLVIDEWKERRERYLA QQ+E VDSV Sbjct: 205 RIVGEGLVIDEWKERRERYLARQQIEGVDSV 235 >ref|XP_002274772.1| PREDICTED: vesicle-associated protein 4-2-like [Vitis vinifera] Length = 259 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +1 Query: 1 RVVGEGLVIDEWKERRERYLAWQQVERVDSV 93 R+VGEGLVIDEWKERRERYLA QQVE +DSV Sbjct: 229 RIVGEGLVIDEWKERRERYLARQQVEGIDSV 259