BLASTX nr result
ID: Panax21_contig00034188
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00034188 (374 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002280704.1| PREDICTED: chloroplastic group IIA intron sp... 56 3e-06 >ref|XP_002280704.1| PREDICTED: chloroplastic group IIA intron splicing facilitator CRS1, chloroplastic-like [Vitis vinifera] Length = 1184 Score = 56.2 bits (134), Expect = 3e-06 Identities = 24/39 (61%), Positives = 30/39 (76%) Frame = +1 Query: 247 VKSEPFLRANFVTKMPTAPWMKGPFLLEPNQVLDLSKSR 363 + S+P + KMPTAPWMKGP LL+PN+VLDLSK+R Sbjct: 61 ISSQPVSGTDAAIKMPTAPWMKGPLLLQPNEVLDLSKAR 99