BLASTX nr result
ID: Panax21_contig00033872
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00033872 (398 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004137642.1| PREDICTED: uncharacterized protein LOC101213... 58 9e-07 ref|XP_002331380.1| predicted protein [Populus trichocarpa] gi|2... 55 5e-06 >ref|XP_004137642.1| PREDICTED: uncharacterized protein LOC101213175 [Cucumis sativus] gi|449531245|ref|XP_004172598.1| PREDICTED: uncharacterized LOC101213175 [Cucumis sativus] Length = 94 Score = 57.8 bits (138), Expect = 9e-07 Identities = 27/51 (52%), Positives = 34/51 (66%) Frame = -1 Query: 386 SKEVCKPTMSLPPFGLASYMLIGDVWLNRGESDYVRLFDLHRAADSWLKQL 234 +K + L PFGLA+Y + GD+WL SDY R+ DL+ AADSWLKQL Sbjct: 28 AKTSASTSTCLSPFGLATYRMQGDLWLMPETSDYERIVDLYHAADSWLKQL 78 >ref|XP_002331380.1| predicted protein [Populus trichocarpa] gi|222873594|gb|EEF10725.1| predicted protein [Populus trichocarpa] Length = 330 Score = 55.5 bits (132), Expect = 5e-06 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = -1 Query: 362 MSLPPFGLASYMLIGDVWLNRGESDYVRLFDLHRAADSWLKQL 234 +SLPPFGLA+Y L G++W+N SD R+ L AADSWLKQL Sbjct: 271 ISLPPFGLATYKLQGNLWINPETSDDERMIYLESAADSWLKQL 313