BLASTX nr result
ID: Panax21_contig00033861
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00033861 (386 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521504.1| cytochrome P450, putative [Ricinus communis]... 67 1e-09 ref|XP_003538868.1| PREDICTED: 3-epi-6-deoxocathasterone 23-mono... 67 1e-09 ref|XP_002267958.1| PREDICTED: 3-epi-6-deoxocathasterone 23-mono... 66 3e-09 ref|XP_003520275.1| PREDICTED: 3-epi-6-deoxocathasterone 23-mono... 64 1e-08 emb|CAN73509.1| hypothetical protein VITISV_007910 [Vitis vinifera] 64 1e-08 >ref|XP_002521504.1| cytochrome P450, putative [Ricinus communis] gi|223539182|gb|EEF40775.1| cytochrome P450, putative [Ricinus communis] Length = 480 Score = 67.4 bits (163), Expect = 1e-09 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = +1 Query: 1 IFLHHFVTSYRWVAEADDIVTFPTVKMKRKLPITIMPMVQQH 126 IFLHH VT+YRWVAE DDIV FPTVKM+RKLPIT+ + Q + Sbjct: 438 IFLHHLVTTYRWVAEKDDIVYFPTVKMRRKLPITVTTLHQPY 479 >ref|XP_003538868.1| PREDICTED: 3-epi-6-deoxocathasterone 23-monooxygenase-like [Glycine max] Length = 483 Score = 67.0 bits (162), Expect = 1e-09 Identities = 28/38 (73%), Positives = 34/38 (89%) Frame = +1 Query: 1 IFLHHFVTSYRWVAEADDIVTFPTVKMKRKLPITIMPM 114 IFLHH VT+YRWVAE D+I+ FPTVKMKRKLPI++ P+ Sbjct: 444 IFLHHLVTTYRWVAERDEIIYFPTVKMKRKLPISVQPI 481 >ref|XP_002267958.1| PREDICTED: 3-epi-6-deoxocathasterone 23-monooxygenase [Vitis vinifera] gi|297735073|emb|CBI17435.3| unnamed protein product [Vitis vinifera] Length = 486 Score = 66.2 bits (160), Expect = 3e-09 Identities = 27/38 (71%), Positives = 34/38 (89%) Frame = +1 Query: 1 IFLHHFVTSYRWVAEADDIVTFPTVKMKRKLPITIMPM 114 IFLHH VT+YRWVA+ DD+V FPTVKM++KLPIT+ P+ Sbjct: 446 IFLHHLVTTYRWVAKKDDVVYFPTVKMRKKLPITVTPL 483 >ref|XP_003520275.1| PREDICTED: 3-epi-6-deoxocathasterone 23-monooxygenase-like [Glycine max] Length = 486 Score = 63.9 bits (154), Expect = 1e-08 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = +1 Query: 1 IFLHHFVTSYRWVAEADDIVTFPTVKMKRKLPITI 105 IFLHH VT+YRWVAE D+I+ FPTVKMKRKLPI++ Sbjct: 448 IFLHHLVTTYRWVAEEDEIIYFPTVKMKRKLPISV 482 >emb|CAN73509.1| hypothetical protein VITISV_007910 [Vitis vinifera] Length = 501 Score = 63.9 bits (154), Expect = 1e-08 Identities = 26/38 (68%), Positives = 33/38 (86%) Frame = +1 Query: 1 IFLHHFVTSYRWVAEADDIVTFPTVKMKRKLPITIMPM 114 IFLHH VT+Y WVA+ DD+V FPTVKM++KLPIT+ P+ Sbjct: 461 IFLHHLVTTYXWVAKKDDVVYFPTVKMRKKLPITVTPL 498