BLASTX nr result
ID: Panax21_contig00033678
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00033678 (368 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003522417.1| PREDICTED: zinc finger CCCH domain-containin... 68 7e-10 ref|XP_002277300.1| PREDICTED: zinc finger CCCH domain-containin... 65 6e-09 ref|XP_002511264.1| nucleic acid binding protein, putative [Rici... 62 4e-08 ref|XP_003525622.1| PREDICTED: zinc finger CCCH domain-containin... 60 1e-07 ref|XP_003549835.1| PREDICTED: zinc finger CCCH domain-containin... 59 3e-07 >ref|XP_003522417.1| PREDICTED: zinc finger CCCH domain-containing protein 43-like [Glycine max] Length = 570 Score = 68.2 bits (165), Expect = 7e-10 Identities = 31/52 (59%), Positives = 40/52 (76%) Frame = -1 Query: 158 EAPVYPMSERSLPTPPAFSMNFPASDAKFYSQHQQQMLLEEYPERPGQPECS 3 +APVY +SERSL P + MN PA ++ Y HQ+QML+EE+PERPG+PECS Sbjct: 419 QAPVY-LSERSLHPPSTYVMNNPAMESNVYMHHQKQMLVEEFPERPGEPECS 469 >ref|XP_002277300.1| PREDICTED: zinc finger CCCH domain-containing protein 43 isoform 1 [Vitis vinifera] gi|297733636|emb|CBI14883.3| unnamed protein product [Vitis vinifera] Length = 484 Score = 65.1 bits (157), Expect = 6e-09 Identities = 32/56 (57%), Positives = 40/56 (71%), Gaps = 4/56 (7%) Frame = -1 Query: 158 EAPVYPMS--ERSLPTPPAFSMNFPASDAKFYSQHQQQM--LLEEYPERPGQPECS 3 +AP+YP ERS+ PPAF +N A+DA Y HQQQ L+E++PERPGQPECS Sbjct: 317 QAPLYPPPPPERSMHPPPAFVINNTATDANVYGHHQQQQQSLIEDFPERPGQPECS 372 >ref|XP_002511264.1| nucleic acid binding protein, putative [Ricinus communis] gi|223550379|gb|EEF51866.1| nucleic acid binding protein, putative [Ricinus communis] Length = 495 Score = 62.4 bits (150), Expect = 4e-08 Identities = 27/48 (56%), Positives = 38/48 (79%) Frame = -1 Query: 146 YPMSERSLPTPPAFSMNFPASDAKFYSQHQQQMLLEEYPERPGQPECS 3 +P+ ERS+ PPA+ ++ PA+D Y+ HQQQ+ +EE+PERPGQPECS Sbjct: 340 FPLYERSMHQPPAYVISNPATDTNVYA-HQQQIQVEEFPERPGQPECS 386 >ref|XP_003525622.1| PREDICTED: zinc finger CCCH domain-containing protein 43-like [Glycine max] Length = 490 Score = 60.5 bits (145), Expect = 1e-07 Identities = 28/52 (53%), Positives = 36/52 (69%) Frame = -1 Query: 158 EAPVYPMSERSLPTPPAFSMNFPASDAKFYSQHQQQMLLEEYPERPGQPECS 3 +A VY + ERS+ P F MN PA D Y HQ+QM ++E+PERPG+PECS Sbjct: 333 QASVY-LPERSIHPPSTFVMNNPAIDTNVYMHHQKQMPVDEFPERPGEPECS 383 >ref|XP_003549835.1| PREDICTED: zinc finger CCCH domain-containing protein 43-like [Glycine max] Length = 501 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/52 (51%), Positives = 36/52 (69%) Frame = -1 Query: 158 EAPVYPMSERSLPTPPAFSMNFPASDAKFYSQHQQQMLLEEYPERPGQPECS 3 +A VY + ER++ P F MN PA D Y HQ+QM ++E+PERPG+PECS Sbjct: 343 QASVY-LPERNMHPPSTFVMNNPAIDTNVYMHHQKQMPVDEFPERPGEPECS 393