BLASTX nr result
ID: Panax21_contig00033647
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00033647 (437 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004137631.1| PREDICTED: monoglyceride lipase-like [Cucumi... 60 2e-07 ref|XP_002533779.1| Monoglyceride lipase, putative [Ricinus comm... 58 7e-07 >ref|XP_004137631.1| PREDICTED: monoglyceride lipase-like [Cucumis sativus] gi|449526024|ref|XP_004170015.1| PREDICTED: monoglyceride lipase-like [Cucumis sativus] Length = 420 Score = 59.7 bits (143), Expect = 2e-07 Identities = 39/94 (41%), Positives = 50/94 (53%) Frame = +3 Query: 150 SNDAAAAIMLTSGASGRVNALLSLRAWKSXXXXXXXXXXXXXXPFRGRRRCSISAAATPV 329 S+ ++++++LTSGASGR+NALLS+RA KS PFRG +R S A P Sbjct: 13 SSSSSSSLILTSGASGRINALLSMRALKSLIMLVNAFVLLLLFPFRGPKR-GQSVADKP- 70 Query: 330 XXXXXXXXXXXXXXXXLPAVRVPATIVPWKSCST 431 P VRVPATIV WKS S+ Sbjct: 71 --------RDDKSERKCPTVRVPATIVSWKSSSS 96 >ref|XP_002533779.1| Monoglyceride lipase, putative [Ricinus communis] gi|223526300|gb|EEF28609.1| Monoglyceride lipase, putative [Ricinus communis] Length = 457 Score = 58.2 bits (139), Expect = 7e-07 Identities = 38/100 (38%), Positives = 49/100 (49%), Gaps = 4/100 (4%) Frame = +3 Query: 150 SNDAAAAIMLTSGASGRVNALLSLRAWKSXXXXXXXXXXXXXXPFRGRRRCSISAAATPV 329 S+ ++ +++LTSGASGR+NAL S+RA KS PFRGRRR + A Sbjct: 55 SSSSSTSLILTSGASGRINALFSVRALKSLLMLINAVVLLLLLPFRGRRRTVPAEKAINN 114 Query: 330 XXXXXXXXXXXXXXXXL----PAVRVPATIVPWKSCSTEV 437 L VRVP TIVPWKS ++ V Sbjct: 115 NSNNNNNKDFEDCGGALRKGSTKVRVPTTIVPWKSSASSV 154