BLASTX nr result
ID: Panax21_contig00033420
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00033420 (474 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003604615.1| Peptide transporter PTR1 [Medicago truncatul... 64 2e-08 ref|XP_002520427.1| peptide transporter, putative [Ricinus commu... 62 4e-08 ref|XP_002298324.1| predicted protein [Populus trichocarpa] gi|2... 62 5e-08 emb|CAO02542.1| putative proton-dependent oligopeptide transport... 61 8e-08 ref|XP_003551296.1| PREDICTED: peptide transporter PTR1-like [Gl... 60 1e-07 >ref|XP_003604615.1| Peptide transporter PTR1 [Medicago truncatula] gi|355505670|gb|AES86812.1| Peptide transporter PTR1 [Medicago truncatula] Length = 577 Score = 63.5 bits (153), Expect = 2e-08 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = -3 Query: 265 GVAEEDDLYTNDGTVDYRNNPSNKRKTGSWKACSYILG 152 GV EED LYT DGT+D NP+NK+KTG+WKAC +ILG Sbjct: 9 GVNEEDGLYTEDGTIDIHKNPANKKKTGNWKACRFILG 46 >ref|XP_002520427.1| peptide transporter, putative [Ricinus communis] gi|223540269|gb|EEF41840.1| peptide transporter, putative [Ricinus communis] Length = 571 Score = 62.4 bits (150), Expect = 4e-08 Identities = 23/35 (65%), Positives = 32/35 (91%) Frame = -3 Query: 256 EEDDLYTNDGTVDYRNNPSNKRKTGSWKACSYILG 152 EE+D+YT DGTVDYR NP++K+KTG+W+AC +I+G Sbjct: 2 EEEDIYTKDGTVDYRGNPASKKKTGTWRACPFIIG 36 >ref|XP_002298324.1| predicted protein [Populus trichocarpa] gi|222845582|gb|EEE83129.1| predicted protein [Populus trichocarpa] Length = 570 Score = 62.0 bits (149), Expect = 5e-08 Identities = 23/34 (67%), Positives = 31/34 (91%) Frame = -3 Query: 253 EDDLYTNDGTVDYRNNPSNKRKTGSWKACSYILG 152 E+D+YT DGTVDYR NP+NK++TG+W+AC YI+G Sbjct: 3 EEDVYTKDGTVDYRGNPANKKETGTWRACPYIIG 36 >emb|CAO02542.1| putative proton-dependent oligopeptide transport (POT) family protein [Vigna unguiculata] gi|149941222|emb|CAO02543.1| putative proton-dependent oligopeptide transport (POT) family protein [Vigna unguiculata] Length = 174 Score = 61.2 bits (147), Expect = 8e-08 Identities = 23/34 (67%), Positives = 31/34 (91%) Frame = -3 Query: 253 EDDLYTNDGTVDYRNNPSNKRKTGSWKACSYILG 152 EDD+YT DGTVD+R NP+NK++TG+W+AC +ILG Sbjct: 3 EDDIYTKDGTVDHRGNPANKKETGTWRACPFILG 36 >ref|XP_003551296.1| PREDICTED: peptide transporter PTR1-like [Glycine max] Length = 572 Score = 60.5 bits (145), Expect = 1e-07 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = -3 Query: 253 EDDLYTNDGTVDYRNNPSNKRKTGSWKACSYILG 152 EDD YT DGTVDY NP+NK++TG+WKAC YILG Sbjct: 3 EDDGYTKDGTVDYCGNPANKKETGTWKACPYILG 36