BLASTX nr result
ID: Panax21_contig00033335
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00033335 (363 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004144985.1| PREDICTED: flap endonuclease GEN-like 1-like... 95 7e-18 gb|AAF76467.1|AC020622_1 Contains similarity to excision repair ... 93 3e-17 ref|NP_001184887.1| 5'-3' exonuclease-like protein [Arabidopsis ... 93 3e-17 ref|NP_171691.2| 5'-3' exonuclease-like protein [Arabidopsis tha... 93 3e-17 ref|XP_002889348.1| hypothetical protein ARALYDRAFT_311256 [Arab... 91 1e-16 >ref|XP_004144985.1| PREDICTED: flap endonuclease GEN-like 1-like [Cucumis sativus] gi|449472478|ref|XP_004153607.1| PREDICTED: flap endonuclease GEN-like 1-like [Cucumis sativus] gi|449516535|ref|XP_004165302.1| PREDICTED: flap endonuclease GEN-like 1-like [Cucumis sativus] Length = 606 Score = 94.7 bits (234), Expect = 7e-18 Identities = 43/51 (84%), Positives = 47/51 (92%) Frame = +2 Query: 209 MGVGGNFWDLLKPYARTEGFNFLRNKRVAVDLSYWIVQHETAIKSNTLNPH 361 MGVGG+FWDLLKP ARTEGF+FLRNKRVAVDLS+WIVQHETAIKS +PH Sbjct: 1 MGVGGHFWDLLKPNARTEGFDFLRNKRVAVDLSFWIVQHETAIKSTARSPH 51 >gb|AAF76467.1|AC020622_1 Contains similarity to excision repair protein ERCC5 from Homo sapiens gi|1082359 and contains XPG N-terminal PF|00752 and XPG I-region PF|00867 domains [Arabidopsis thaliana] Length = 497 Score = 92.8 bits (229), Expect = 3e-17 Identities = 40/51 (78%), Positives = 46/51 (90%) Frame = +2 Query: 209 MGVGGNFWDLLKPYARTEGFNFLRNKRVAVDLSYWIVQHETAIKSNTLNPH 361 MGVGGNFWDLL+PYA+ +GF+FLRNKRVAVDLS+WIVQHETA+K L PH Sbjct: 1 MGVGGNFWDLLRPYAQQQGFDFLRNKRVAVDLSFWIVQHETAVKGFVLKPH 51 >ref|NP_001184887.1| 5'-3' exonuclease-like protein [Arabidopsis thaliana] gi|332189225|gb|AEE27346.1| 5'-3' exonuclease-like protein [Arabidopsis thaliana] Length = 598 Score = 92.8 bits (229), Expect = 3e-17 Identities = 40/51 (78%), Positives = 46/51 (90%) Frame = +2 Query: 209 MGVGGNFWDLLKPYARTEGFNFLRNKRVAVDLSYWIVQHETAIKSNTLNPH 361 MGVGGNFWDLL+PYA+ +GF+FLRNKRVAVDLS+WIVQHETA+K L PH Sbjct: 1 MGVGGNFWDLLRPYAQQQGFDFLRNKRVAVDLSFWIVQHETAVKGFVLKPH 51 >ref|NP_171691.2| 5'-3' exonuclease-like protein [Arabidopsis thaliana] gi|357529503|sp|Q9LPD2.3|GENL1_ARATH RecName: Full=Flap endonuclease GEN-like 1 gi|332189224|gb|AEE27345.1| 5'-3' exonuclease-like protein [Arabidopsis thaliana] Length = 599 Score = 92.8 bits (229), Expect = 3e-17 Identities = 40/51 (78%), Positives = 46/51 (90%) Frame = +2 Query: 209 MGVGGNFWDLLKPYARTEGFNFLRNKRVAVDLSYWIVQHETAIKSNTLNPH 361 MGVGGNFWDLL+PYA+ +GF+FLRNKRVAVDLS+WIVQHETA+K L PH Sbjct: 1 MGVGGNFWDLLRPYAQQQGFDFLRNKRVAVDLSFWIVQHETAVKGFVLKPH 51 >ref|XP_002889348.1| hypothetical protein ARALYDRAFT_311256 [Arabidopsis lyrata subsp. lyrata] gi|297335190|gb|EFH65607.1| hypothetical protein ARALYDRAFT_311256 [Arabidopsis lyrata subsp. lyrata] Length = 590 Score = 90.9 bits (224), Expect = 1e-16 Identities = 39/51 (76%), Positives = 45/51 (88%) Frame = +2 Query: 209 MGVGGNFWDLLKPYARTEGFNFLRNKRVAVDLSYWIVQHETAIKSNTLNPH 361 MGVGGNFWDLL+PYA+ GF++LRNKRVAVDLS+WIVQHETA+K L PH Sbjct: 1 MGVGGNFWDLLRPYAQQRGFDYLRNKRVAVDLSFWIVQHETAVKGFVLKPH 51