BLASTX nr result
ID: Panax21_contig00033233
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00033233 (354 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAB97736.1| NADPH cytochrome P450 reductase [Petroselinum cri... 59 4e-07 gb|AAS90127.1| NADPH cytochrome P450 reductase [Ammi majus] 57 1e-06 >gb|AAB97736.1| NADPH cytochrome P450 reductase [Petroselinum crispum] Length = 681 Score = 58.9 bits (141), Expect = 4e-07 Identities = 29/40 (72%), Positives = 31/40 (77%) Frame = +3 Query: 213 TTVVLEYRVVVHDQTYTPLLNRSLSMQNGHTVFDAQHPYR 332 T VLEYRVVV+DQ T L+RSLS QNGHTV DAQHP R Sbjct: 244 TAAVLEYRVVVYDQLDTATLDRSLSTQNGHTVHDAQHPCR 283 >gb|AAS90127.1| NADPH cytochrome P450 reductase [Ammi majus] Length = 681 Score = 57.4 bits (137), Expect = 1e-06 Identities = 28/40 (70%), Positives = 31/40 (77%) Frame = +3 Query: 213 TTVVLEYRVVVHDQTYTPLLNRSLSMQNGHTVFDAQHPYR 332 T VLEYRVVV+DQ T L++SLS QNGHTV DAQHP R Sbjct: 244 TAAVLEYRVVVYDQPDTATLDQSLSTQNGHTVHDAQHPCR 283