BLASTX nr result
ID: Panax21_contig00033229
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00033229 (931 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN65986.1| hypothetical protein VITISV_042143 [Vitis vinifera] 72 2e-10 ref|XP_002534720.1| conserved hypothetical protein [Ricinus comm... 62 1e-07 >emb|CAN65986.1| hypothetical protein VITISV_042143 [Vitis vinifera] Length = 138 Score = 71.6 bits (174), Expect = 2e-10 Identities = 33/38 (86%), Positives = 34/38 (89%) Frame = -2 Query: 930 TPFSKESYVRLSRHTAPPRNQDLPFPLTNGSSNQPVLP 817 TPFSKE YV LSRHTAP RN+DLPFPLTNGSSNQPV P Sbjct: 24 TPFSKEPYVTLSRHTAPSRNKDLPFPLTNGSSNQPVPP 61 >ref|XP_002534720.1| conserved hypothetical protein [Ricinus communis] gi|223524693|gb|EEF27662.1| conserved hypothetical protein [Ricinus communis] Length = 77 Score = 62.4 bits (150), Expect = 1e-07 Identities = 31/38 (81%), Positives = 34/38 (89%), Gaps = 1/38 (2%) Frame = -1 Query: 931 YTLLKGIVRETLASYGSAPESG-PPLSFDQRVLKPTCP 821 +TLLKG VR+TLASYGSAPESG PP SFDQRVL+PT P Sbjct: 16 HTLLKGTVRDTLASYGSAPESGPPPFSFDQRVLEPTFP 53