BLASTX nr result
ID: Panax21_contig00033162
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00033162 (575 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002283165.1| PREDICTED: uncharacterized protein LOC100249... 145 4e-33 ref|XP_002330826.1| predicted protein [Populus trichocarpa] gi|2... 141 9e-32 ref|XP_004138779.1| PREDICTED: uncharacterized protein LOC101209... 134 1e-29 ref|XP_003603567.1| hypothetical protein MTR_3g109170 [Medicago ... 127 1e-27 ref|NP_850052.1| chaperone protein dnaJ-related protein [Arabido... 125 5e-27 >ref|XP_002283165.1| PREDICTED: uncharacterized protein LOC100249288 isoform 1 [Vitis vinifera] gi|296081792|emb|CBI20797.3| unnamed protein product [Vitis vinifera] Length = 101 Score = 145 bits (367), Expect = 4e-33 Identities = 59/71 (83%), Positives = 68/71 (95%) Frame = -2 Query: 574 VDGGILCEPCNGRGWLLCDFCKGQKTNVKAENKRIYRRCPSCRAVGYLLCSNCKVYKCVT 395 +D GI+CEPCNG+GWLLCDFCKGQKTNVKAEN RIYRRCPSCRA+GY+LCS CKV+KCVT Sbjct: 30 IDVGIMCEPCNGKGWLLCDFCKGQKTNVKAENNRIYRRCPSCRAIGYVLCSKCKVFKCVT 89 Query: 394 FPNYNDGKDLN 362 FPNY+DG++LN Sbjct: 90 FPNYDDGEELN 100 >ref|XP_002330826.1| predicted protein [Populus trichocarpa] gi|222872628|gb|EEF09759.1| predicted protein [Populus trichocarpa] Length = 121 Score = 141 bits (355), Expect = 9e-32 Identities = 57/69 (82%), Positives = 65/69 (94%) Frame = -2 Query: 574 VDGGILCEPCNGRGWLLCDFCKGQKTNVKAENKRIYRRCPSCRAVGYLLCSNCKVYKCVT 395 V GI+CEPCNG+GWLLCDFCKG KTNVKA+NKR+YRRCPSCRA+GY+LCS CKV+KCVT Sbjct: 50 VASGIMCEPCNGKGWLLCDFCKGLKTNVKADNKRLYRRCPSCRAIGYVLCSKCKVFKCVT 109 Query: 394 FPNYNDGKD 368 FPNYNDG+D Sbjct: 110 FPNYNDGED 118 >ref|XP_004138779.1| PREDICTED: uncharacterized protein LOC101209431 [Cucumis sativus] gi|449499504|ref|XP_004160834.1| PREDICTED: uncharacterized LOC101209431 [Cucumis sativus] Length = 112 Score = 134 bits (336), Expect = 1e-29 Identities = 54/70 (77%), Positives = 63/70 (90%) Frame = -2 Query: 571 DGGILCEPCNGRGWLLCDFCKGQKTNVKAENKRIYRRCPSCRAVGYLLCSNCKVYKCVTF 392 D I CEPCNG+GW++CDFC+GQKTNVK E RIYRRCP+CRAVGY+LCSNCKV+KCVTF Sbjct: 42 DSTIDCEPCNGKGWIVCDFCEGQKTNVKVEKNRIYRRCPTCRAVGYVLCSNCKVFKCVTF 101 Query: 391 PNYNDGKDLN 362 PN+NDG DL+ Sbjct: 102 PNFNDGADLS 111 >ref|XP_003603567.1| hypothetical protein MTR_3g109170 [Medicago truncatula] gi|355492615|gb|AES73818.1| hypothetical protein MTR_3g109170 [Medicago truncatula] Length = 117 Score = 127 bits (320), Expect = 1e-27 Identities = 50/62 (80%), Positives = 60/62 (96%) Frame = -2 Query: 562 ILCEPCNGRGWLLCDFCKGQKTNVKAENKRIYRRCPSCRAVGYLLCSNCKVYKCVTFPNY 383 I+C+PCNG+GWL+CDFC+GQKTNVKA N RIYRRCPSC+AVGY+LCSNCKV+KCVTFP++ Sbjct: 52 IMCDPCNGKGWLVCDFCEGQKTNVKAPNNRIYRRCPSCKAVGYVLCSNCKVFKCVTFPHF 111 Query: 382 ND 377 ND Sbjct: 112 ND 113 >ref|NP_850052.1| chaperone protein dnaJ-related protein [Arabidopsis thaliana] gi|44917527|gb|AAS49088.1| At2g24395 [Arabidopsis thaliana] gi|62321035|dbj|BAD94100.1| hypothetical protein [Arabidopsis thaliana] gi|330252477|gb|AEC07571.1| chaperone protein dnaJ-related protein [Arabidopsis thaliana] Length = 132 Score = 125 bits (314), Expect = 5e-27 Identities = 51/66 (77%), Positives = 59/66 (89%) Frame = -2 Query: 562 ILCEPCNGRGWLLCDFCKGQKTNVKAENKRIYRRCPSCRAVGYLLCSNCKVYKCVTFPNY 383 ILCE CNG+GWLLCDFCKGQKTNVK+EN RIYRRCP+C+AVG++LC CKV+KCVTFPN Sbjct: 65 ILCEDCNGKGWLLCDFCKGQKTNVKSENNRIYRRCPTCKAVGFVLCRKCKVFKCVTFPNS 124 Query: 382 NDGKDL 365 DG +L Sbjct: 125 EDGDEL 130