BLASTX nr result
ID: Panax21_contig00032965
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00032965 (406 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003594711.1| 3-5 exonuclease/ nucleic acid binding protei... 47 5e-11 ref|XP_003594713.1| Werner syndrome ATP-dependent helicase [Medi... 39 6e-06 >ref|XP_003594711.1| 3-5 exonuclease/ nucleic acid binding protein [Medicago truncatula] gi|355483759|gb|AES64962.1| 3-5 exonuclease/ nucleic acid binding protein [Medicago truncatula] Length = 219 Score = 46.6 bits (109), Expect(2) = 5e-11 Identities = 21/39 (53%), Positives = 30/39 (76%) Frame = +3 Query: 192 ISRSDWDNEKLSMKQVVQACVEARAAFLMGTDIRAWQLS 308 I RS+W++E LS KQVV A V+A AFL+G +I+AW+ + Sbjct: 180 IGRSNWNDEDLSHKQVVYASVDAYCAFLIGKNIKAWRFT 218 Score = 45.4 bits (106), Expect(2) = 5e-11 Identities = 20/35 (57%), Positives = 25/35 (71%) Frame = +1 Query: 1 FVGFWNHFDARKLAI*RHELKMDRPPLDLRVYAKS 105 FVGFWNH D RKL + +H + R PLDLR YA++ Sbjct: 112 FVGFWNHSDRRKLEMSKHGFDLYRDPLDLRHYAEA 146 >ref|XP_003594713.1| Werner syndrome ATP-dependent helicase [Medicago truncatula] gi|355483761|gb|AES64964.1| Werner syndrome ATP-dependent helicase [Medicago truncatula] Length = 277 Score = 39.3 bits (90), Expect(2) = 6e-06 Identities = 25/55 (45%), Positives = 31/55 (56%) Frame = +1 Query: 1 FVGFWNHFDARKLAI*RHELKMDRPPLDLRVYAKSKSTGGSLVGASRRDIVREFL 165 FVGFWN D RKL H L+M + P DLR Y + G +L S +IVR+ L Sbjct: 115 FVGFWNAADRRKLERFDHRLQMWKNPQDLRNY---EFNGEALSRLSMDEIVRKCL 166 Score = 35.4 bits (80), Expect(2) = 6e-06 Identities = 15/38 (39%), Positives = 23/38 (60%) Frame = +3 Query: 192 ISRSDWDNEKLSMKQVVQACVEARAAFLMGTDIRAWQL 305 + RS+W+ E L QV A ++A AFL+G +AW + Sbjct: 176 VGRSNWNQENLYAHQVAYASIDAYFAFLIGICFQAWSV 213