BLASTX nr result
ID: Panax21_contig00032753
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00032753 (417 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EAY93252.1| hypothetical protein OsI_15058 [Oryza sativa Indi... 86 4e-15 ref|XP_002279824.1| PREDICTED: pentatricopeptide repeat-containi... 85 7e-15 ref|NP_001167864.1| pentatricopeptide repeat (PPR) superfamily p... 85 7e-15 ref|NP_001159270.1| uncharacterized protein LOC100304360 [Zea ma... 85 7e-15 emb|CAN64107.1| hypothetical protein VITISV_013147 [Vitis vinifera] 85 7e-15 >gb|EAY93252.1| hypothetical protein OsI_15058 [Oryza sativa Indica Group] Length = 407 Score = 85.5 bits (210), Expect = 4e-15 Identities = 36/52 (69%), Positives = 49/52 (94%) Frame = +2 Query: 260 VDVLGKSGHLNEAMEFVENMPIEPTAEIWEALVNLSRMHGDIELEDRAKELL 415 ++VLGKSGHLNEA+E++E +P EPTA +WE+L+NL+RM+GDI+LEDRA+ELL Sbjct: 213 IEVLGKSGHLNEAVEYIEKLPFEPTATVWESLLNLARMNGDIDLEDRAEELL 264 >ref|XP_002279824.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15690-like [Vitis vinifera] Length = 476 Score = 84.7 bits (208), Expect = 7e-15 Identities = 38/52 (73%), Positives = 46/52 (88%) Frame = +2 Query: 260 VDVLGKSGHLNEAMEFVENMPIEPTAEIWEALVNLSRMHGDIELEDRAKELL 415 +DVLGK GH+NEA EFV+ MPIEPTAE+WEAL N +R+HG IELEDRA+E+L Sbjct: 272 IDVLGKFGHINEAEEFVDKMPIEPTAEVWEALRNFARIHGAIELEDRAEEML 323 >ref|NP_001167864.1| pentatricopeptide repeat (PPR) superfamily protein [Zea mays] gi|223944527|gb|ACN26347.1| unknown [Zea mays] gi|413946729|gb|AFW79378.1| pentatricopeptide repeat (PPR) superfamily protein [Zea mays] Length = 578 Score = 84.7 bits (208), Expect = 7e-15 Identities = 36/52 (69%), Positives = 48/52 (92%) Frame = +2 Query: 260 VDVLGKSGHLNEAMEFVENMPIEPTAEIWEALVNLSRMHGDIELEDRAKELL 415 ++VLGKSGHLNEA+EF+E +P EP A +WE+L+NL+RM+GDI+LEDRA+ELL Sbjct: 384 IEVLGKSGHLNEALEFIEKLPFEPNAMVWESLLNLARMNGDIDLEDRAEELL 435 >ref|NP_001159270.1| uncharacterized protein LOC100304360 [Zea mays] gi|223943115|gb|ACN25641.1| unknown [Zea mays] gi|413948667|gb|AFW81316.1| pentatricopeptide repeat (PPR) superfamily protein [Zea mays] Length = 580 Score = 84.7 bits (208), Expect = 7e-15 Identities = 36/52 (69%), Positives = 48/52 (92%) Frame = +2 Query: 260 VDVLGKSGHLNEAMEFVENMPIEPTAEIWEALVNLSRMHGDIELEDRAKELL 415 ++VLGKSGHLNEA+EF+E +P EP A +WE+L+NL+RM+GDI+LEDRA+ELL Sbjct: 386 IEVLGKSGHLNEALEFIEKLPFEPNAMVWESLLNLARMNGDIDLEDRAEELL 437 >emb|CAN64107.1| hypothetical protein VITISV_013147 [Vitis vinifera] Length = 497 Score = 84.7 bits (208), Expect = 7e-15 Identities = 38/52 (73%), Positives = 46/52 (88%) Frame = +2 Query: 260 VDVLGKSGHLNEAMEFVENMPIEPTAEIWEALVNLSRMHGDIELEDRAKELL 415 +DVLGK GH+NEA EFV+ MPIEPTAE+WEAL N +R+HG IELEDRA+E+L Sbjct: 274 IDVLGKFGHINEAEEFVDKMPIEPTAEVWEALRNFARIHGAIELEDRAEEML 325