BLASTX nr result
ID: Panax21_contig00031364
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00031364 (545 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004157974.1| PREDICTED: LOW QUALITY PROTEIN: alpha-glucos... 73 3e-11 ref|XP_004144332.1| PREDICTED: alpha-glucosidase YihQ-like [Cucu... 73 3e-11 ref|XP_002308887.1| predicted protein [Populus trichocarpa] gi|2... 72 7e-11 ref|XP_002522166.1| alpha-xylosidase, putative [Ricinus communis... 70 2e-10 ref|XP_003521128.1| PREDICTED: alpha-glucosidase yihQ-like [Glyc... 67 1e-09 >ref|XP_004157974.1| PREDICTED: LOW QUALITY PROTEIN: alpha-glucosidase YihQ-like [Cucumis sativus] Length = 880 Score = 72.8 bits (177), Expect = 3e-11 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = +1 Query: 232 SDIEGYCAVNLPFLKYQRSEELLLRWMELNAFTTVF 339 SDI GYCAVNLPF+KY+RSEELLLRWMELNAFTTVF Sbjct: 691 SDIGGYCAVNLPFIKYRRSEELLLRWMELNAFTTVF 726 >ref|XP_004144332.1| PREDICTED: alpha-glucosidase YihQ-like [Cucumis sativus] Length = 880 Score = 72.8 bits (177), Expect = 3e-11 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = +1 Query: 232 SDIEGYCAVNLPFLKYQRSEELLLRWMELNAFTTVF 339 SDI GYCAVNLPF+KY+RSEELLLRWMELNAFTTVF Sbjct: 691 SDIGGYCAVNLPFIKYRRSEELLLRWMELNAFTTVF 726 >ref|XP_002308887.1| predicted protein [Populus trichocarpa] gi|222854863|gb|EEE92410.1| predicted protein [Populus trichocarpa] Length = 875 Score = 71.6 bits (174), Expect = 7e-11 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +1 Query: 232 SDIEGYCAVNLPFLKYQRSEELLLRWMELNAFTTVF 339 SDI GYCAVNLPF+KY RSEELL+RWMELNAFTTVF Sbjct: 686 SDIGGYCAVNLPFIKYHRSEELLMRWMELNAFTTVF 721 >ref|XP_002522166.1| alpha-xylosidase, putative [Ricinus communis] gi|223538604|gb|EEF40207.1| alpha-xylosidase, putative [Ricinus communis] Length = 874 Score = 70.5 bits (171), Expect = 2e-10 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = +1 Query: 232 SDIEGYCAVNLPFLKYQRSEELLLRWMELNAFTTVF 339 SDI GYCAVN+PF+KY RSEELL+RWMELNAFTTVF Sbjct: 685 SDIGGYCAVNMPFVKYHRSEELLMRWMELNAFTTVF 720 >ref|XP_003521128.1| PREDICTED: alpha-glucosidase yihQ-like [Glycine max] Length = 878 Score = 67.4 bits (163), Expect = 1e-09 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +1 Query: 232 SDIEGYCAVNLPFLKYQRSEELLLRWMELNAFTTVF 339 SDI GYC VNLP +KY+RSEELLLRWMELN+FTTVF Sbjct: 689 SDIGGYCTVNLPIVKYRRSEELLLRWMELNSFTTVF 724