BLASTX nr result
ID: Panax21_contig00031130
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00031130 (378 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003535445.1| PREDICTED: actin-related protein 9-like [Gly... 56 3e-06 >ref|XP_003535445.1| PREDICTED: actin-related protein 9-like [Glycine max] Length = 591 Score = 56.2 bits (134), Expect = 3e-06 Identities = 24/44 (54%), Positives = 31/44 (70%) Frame = +3 Query: 165 YRECLFSETTLKIFLTKPYCLCRHIHEGHLNISQRYTRQQVIDD 296 ++E + E L+I T+PYC CR I GHLNISQ Y+ QQV+DD Sbjct: 168 FKEFICGEEALRISPTEPYCFCRPIRRGHLNISQHYSMQQVLDD 211