BLASTX nr result
ID: Panax21_contig00029349
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00029349 (697 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002438922.1| hypothetical protein SORBIDRAFT_10g028330 [S... 56 6e-06 gb|ABD63183.1| hypothetical protein 20.t00035 [Asparagus officin... 56 8e-06 >ref|XP_002438922.1| hypothetical protein SORBIDRAFT_10g028330 [Sorghum bicolor] gi|241917145|gb|EER90289.1| hypothetical protein SORBIDRAFT_10g028330 [Sorghum bicolor] Length = 596 Score = 56.2 bits (134), Expect = 6e-06 Identities = 30/82 (36%), Positives = 42/82 (51%) Frame = +2 Query: 299 MAVTMTILEKGVRFPLHAFIVTILGFLGVGFAQLMSNSYIHILAFIALCHELGVEPTLDF 478 M V LE G+RFPLH F V +L + +QL N++ ++ AF+ LC + GVEP + Sbjct: 93 MCVYAAALEAGLRFPLHGFYVRVLRHYCLAPSQLTPNAWTYLAAFVLLCEDAGVEPLVSA 152 Query: 479 FFTVYKVNQSREKGFKTISKHF 544 F + V R G HF Sbjct: 153 FRYFFTVCAHRHDGKPLGCHHF 174 >gb|ABD63183.1| hypothetical protein 20.t00035 [Asparagus officinalis] Length = 210 Score = 55.8 bits (133), Expect = 8e-06 Identities = 35/97 (36%), Positives = 52/97 (53%) Frame = +2 Query: 182 SKVTEIDLKKL*TRCHIPDTHLVRAPRSEERMYQRPERWMAVTMTILEKGVRFPLHAFIV 361 SKV +L L + +I T + AP E +Y E + + + LE G+R PLH FI Sbjct: 23 SKVHMDNLLGLYDQYNISQTLTLVAPEISEPVYCHGEDQVPLYLAHLEHGLRLPLHPFIK 82 Query: 362 TILGFLGVGFAQLMSNSYIHILAFIALCHELGVEPTL 472 + LGV Q N+ ++AFI +CH +GV+P+L Sbjct: 83 EVHTALGVSPFQFYPNTVGILVAFIIICHRVGVQPSL 119